GSP1

GTP-binding nuclear protein GSP1/CNR1

219 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.

Belongs to the small GTPase superfamily. Ran family.

24.81 kDa

MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

GSP1

GTP-binding nuclear protein GSP1/Ran

214 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).

Belongs to the small GTPase superfamily. Ran family.

24.368 kDa

MAAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMERATALPLPDEDDADL

GSP1

GTP-binding nuclear protein GSP1/Ran

214 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).

Belongs to the small GTPase superfamily. Ran family.

24.314 kDa

MAQEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLGFHTNFGELKFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPQLEFVASPALAPPEVQVDADLMQKYQQEMEQATALPLPDEDDADL

GSP1

GTP-binding nuclear protein GSP1/Ran

214 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).

Belongs to the small GTPase superfamily. Ran family.

24.344 kDa

MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

GSP1

GTP-binding nuclear protein GSP1

214 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export (By similarity).

Belongs to the small GTPase superfamily. Ran family.

24.364 kDa

MERRELTYKICLIGDGGVGKTTYINRVLDGRFEKNYNATVGAVNHPVTFLDDQGNVIKFNVWDTAGQEKKAVLKDVYYIGASGAIFFFDVTSRITCQNLARWVKEFQAVVGNEAPIVVCANKIDIKNRQKISKKLVMEVLKGKNYEYFEISAKTAHNFGLPFLHLARIFTGRPDLIFVSNVNLEPTEVNYDYHSPEESKYIDYMEQASKMAPEE

GSP1

GTP-binding nuclear protein GSP1/Ran

214 amino acids

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).

Belongs to the small GTPase superfamily. Ran family.

24.17 kDa

MSQEVAAFKLVLVGDGGTGKTTFVKRHETGEFVNRYNATLGVEVHPLNFATDCGNIRFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPSLEFVATPALRPAETAIDPEVMQAMQKDLEEANAMPLPDEDDADF