GLCAK2

Probable glucuronokinase 2

366 amino acids

Sugar-1-kinase with a strict substrate specificity for D-glucuronic acid and ATP. Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers. May be also involved in a salvage pathway for glucuronic acid (By similarity).

Belongs to the GHMP kinase family.

40.861 kDa

MDPNPKPAISGKDNGVFEHRSFARIGFLGNPSDVYFGRTISFTIGNFWAWAKLEPSDHLLIKPHPFHDLVQFDSLDNLVYRLENDGYYGGVRLLMAICKVFRNYCKENGIQLHDKNFTLSYDTNIPRQTGLSGSSAIVSAALSCLLDFYNVRQSIRIEVRPNLILNAEKELGIVAGLQDRVAQVYGGGLVHMDFSKEHMDKVGYGIYTIMDINLLPPLHLIYAENPSDSGKVHSTVRRRWLDGDEFIISSMAEIAKLAEEGRTALLKKDYSNLKELMNRNFDLRRSMFGDECLGAMNIEMVEVARKIGAAAKFTGSGGAVVVFCPEGPSQVKLLEEECRKSGFIVEPVKLVPTRLSSSDIKTLSKT