GJC3

Gap junction gamma-3 protein

279 amino acids

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Belongs to the connexin family. Gamma-type subfamily.

31.299 kDa

MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

GJC3

Gap junction gamma-3 protein

275 amino acids

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Belongs to the connexin family. Gamma-type subfamily.

30.265 kDa

MCGSFLRRVAAEESRHPTPVGRLLLPALLGLRLVLLAAGGTGVFGGGEEQSEFVCHTQQAGCKAVCYDAFHPLSPLRFWAFQVTLVAVPSALYMGFILYHVIWHWEASEKVKTEEETLSQGEKGGEASRAGSSRLLWAYVAQLGVRLALEGAALGGQYHLYGFRMPSSFVCRLEPCLGSTNCYLSRPSEKSIFLKTMFGVTGLCLLFTLLELVLLGLGRWWRIWRHKSPSSNYSPTSQSAKRCKAPTDNFPVVEIRERPGEAGERGSEVPLSARP

Gjc3

Gap junction gamma-3 protein

269 amino acids

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Belongs to the connexin family. Gamma-type subfamily.

30.293 kDa

MLLLELPIKCRMCGRFLRQLLAQESQHSTPVGRFLLPMLMGFRLLILVSSGPGVFGNDENEFICHLGQPGCKTICYDVFRPLSPLRFWAFQVILMAVPSAIYVAFTLYHVIGYWEVPGKENKEQETQISKGDHSKDVSGAKSLKLLWAYVAHLGVRLALEGAALGVQYNLYGFKMSSTFICREDPCIGSTTCFQSHPSEKTIFLNIMFGISGACFLFIFLELALLGLGRFWRIYKHKLSFLKKLPTSESSVRSKDTTDELSVVEAKEPF