GINS4

DNA replication complex GINS protein SLD5

223 amino acids

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA (By similarity).

Belongs to the GINS4/SLD5 family.

26.08 kDa

MAEEADLLGQDSDGDSEEVILTPAELIDRLEQAWMNEKFAPELLENKSEIVECVMEQLEHMEENLKRAKKGDLKVSIHQMEMERIRFVLSSYLRCRLMKIEKFFPHTLEKEKTRREEEPPILSPEELVFAKEFLANTETYLKDTALKHMPPNLQKVDLLRTVPKPDLDAYVFLRVKERQENILVEPENDEQRDYVIDLEEGSQHLMRYRTVAPLVASGAIQLI

GINS4

DNA replication complex GINS protein SLD5

223 amino acids

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.

Belongs to the GINS4/SLD5 family.

26.047 kDa

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI

Gins4

DNA replication complex GINS protein SLD5

223 amino acids

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA (By similarity).

Belongs to the GINS4/SLD5 family.

25.961 kDa

MTEVLDLHGQDSDGGSEEMVLTPAELIEKLEQAWMNEKFAPELLESKAEIVECVMEQLEHMEENLRRAKKGDLKVSIHRMEMERIRYVLSSYLRCRLMKIEKFFPHILEKEKVRSEGEPSSLSPEEFVFAKEYMDHTETHFKNVALKHMPPNLQKVDLLRAVPKPDLDSYVFLRVKERQENILVEPEADEQRDYVIDLEVGSQHLIRYKTIAPLVASGAVQLI

Gins4

DNA replication complex GINS protein SLD5

223 amino acids

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. SLD5 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA (By similarity).

Belongs to the GINS4/SLD5 family.

26.062 kDa

MTEVQDLHGQDSDEGSEEVVLTPAELIERLEQAWMNEKFAPELLESKSEIVECVMEQLEHMEENLRRAKKGDLKVSIHRMEMERIRYVLSSYLRCRLMKIEKFFPHILEKEKTRPAGEPSSLSPEEFVFAKEYMDHTETHFKNVALKHMPPNLQKVDLMRAVPKPDLDSYVFLRVKERQENILVEPEADEQRDYVIDLEEGSQHLIRYKTIAPLVASGAVQLI

gins4

DNA replication complex GINS protein SLD5

211 amino acids

The GINS complex plays an essential role in the initiation of DNA replication.

Belongs to the GINS4/SLD5 family.

24.943 kDa

MMSGEYGDFNNTNNKELSLLDKLKKAWINEKYAPNLLNYEDVIIKEVMEKIEEKESLCASAISNINLQFTANIYEMEIERLKYIIKCYLVQRIKKIDKFYSSILLEIENDEYDSYKLLSEFEINYCQKYKALMDGYFKNTLLNSIPKDFQKMDSNSINRPFLNTFVFCKPREDLGDFLVDDETIDFKKTSIYFLKYLPIKSLVEGGKMDLI