About Services Proteins Contact

Fphi_1781

Gene
Fphi_1781
Protein
UPF0145 protein Fphi_1781
Organism
Francisella philomiragia subsp. philomiragia (strain ATCC 25017)
Length
106 amino acids
Similarity
Belongs to the UPF0145 family.
Mass
11.29 kDa
Sequence
MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGGKNTSYTNVCKEARLHAEQEMINQAQELGANAIVAIRYDSSSLGGTTSGTEVFCYGTAVVIR