Function
A neural-specific transcription factor that can act as both a transcriptional activator and a transcriptional repressor. Both represses and activates neuronal differentiation in a dose-dependent manner, independently regulating cell fate choice and cell proliferation. Converts ectoderm to a neural fate. Suppresses the transcription of the cell cycle inhibitor p27xic1 and promotes the proliferation of neuroectodermal cells at a high concentration. Promotes the transcription of p27xic1 and inhibits ectodermal proliferation at low concentrations. The transcription factors foxd1 and foxg1 mutually repress each other to pattern the forebrain.
Sequence
MLDMGDRKEVKMIPKSSFSINSLMPEAVQNDNHPQPHHHHHHQQQPQHLQLPQQHHLQPHHRPLQEEDELDKSLLEVKTESLPPGKGDPAASELPGEDKDKIDDKKVDGKDGDSGKDGGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSQPMPYSSVLTQNSLGNNHSFSTSNGLSVDRLVNGEIPYATHHLTAAALAASVPCGLPVPCSGTYSLNPCSVNLLAGQTGYFFPHVPHPSITSQSSTSMAARAASSSTSPQAPSTLPCESLRPALPSFTTGLSGGLSDYFTHQNQGSSSNSLIH