About Services Proteins Contact

FOXD1

Gene
FOXD1
Protein
Forkhead box protein D1
Organism
Homo sapiens
Length
465 amino acids
Function
Transcription factor involved in regulation of gene expression in a variety of processes, including formation of positional identity in the developing retina, regionalization of the optic chiasm, morphogenesis of the kidney, and neuralization of ectodermal cells (By similarity). Involved in transcriptional activation of PGF and C3 genes (PubMed:27805902).
Mass
46.14 kDa
Sequence
MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFAAAAAAAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAAKAGGPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPAAALTRSLVAAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC

Gene
Foxd1
Protein
Forkhead box protein D1
Organism
Mus musculus
Length
456 amino acids
Function
Transcription factor involved in regulation of gene expression in a variety of processes including formation of positional identity in the developing retina, regionalization of the optic chiasm, morphogenesis of the kidney, and neuralization of ectodermal cells (PubMed:15509772, PubMed:15634693, PubMed:9811586). Involved in transcriptional activation of PGF and C3 genes (By similarity).
Mass
45.371 kDa
Sequence
MTLSTEMSDASGLAEETDIDVVGEGEDDEEEEDDDDEGGGGRGGGGSRLPSSAQRRRRSYAGEDDLEDLEEEDDDDLLLASRPAASPAPPGPAPAPGTGSGGCSGAGAGGGAGGGTGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLAPHAAAEALLLRGAGPAAGAGDPGAALFPPPPPPPACGYGAYGCAYGLQLPPCAPPSALFAAAAAAAAAAFHPHSPPPPPPPPPPPPGAAAELARTAFGYRSHALAAALPGPLQAAAVKAGGPGAAALARSPFSIESLIGRTRGPAAAGAHVSSGAASGTAPGPGGGGCAVQAAAGPAVALTRSLVVAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC

Gene
FOXD1
Protein
Forkhead box protein D1
Organism
Gallus gallus
Length
440 amino acids
Function
May determine the nasotemporal axis of the retina, and consequently specify the topographical projection of the retinal ganglion-cell axons to the tectum by controlling expression of their target genes.
Mass
44.67 kDa
Sequence
MTLSSEMSEASALAEETDIDVVGEEDDEEDEEEPQPRHRRRRRSYAEDEEEEEEEEEEDAGDLHDDALLPRSPVRAGGGGGGGGGGGGAGGGDGPGGSRPPSRGGPQKAAAAGGGGAGGGGGGGGGAGGGGGGGGGGKNSLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQLPAPELLLRAVDPAAFLPQPPPQPPQQPPCAYGPYGCGYGLQLQPYHPHSALFAFHHPSPPPRQPPAAPAGAPAAALPPPPPPPPPPRRRAPLLPAAELARTPFGYPHPLGPALAASLHAAKPGSGAAVARSPFSIESIIGGGPGPGLGAGPAPGAGGSCASQSGAATGLSRSLGSGLAPAAALPAAPGLAARISNC

Gene
foxd1
Protein
Forkhead box protein D1
Organism
Xenopus laevis
Length
345 amino acids
Function
Transcriptional repressor that down-regulates bmp4 signaling in both mesoderm and ectoderm. Regulates mesoderm patterning by repressing ventral mesoderm genes and promoting the expression of dorsolateral genes. Can also neuralize ectodermal cells directly. Inhibits neural crest migration. The transcription factors foxd1 and foxg1 mutually repress each other to pattern the forebrain.
Mass
38.049 kDa
Sequence
MTLSSDMSDVLAEETDIDVVGEEDEPRAEEEEEEDGELLMPRSPHCSSTKDPYKAAGSGGVGRSALVKPPYSYIALITMSILQSPKKRLTLSEICDFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQVPELVLREPGHFLPASAYGYGPYSCAYGIQIQPFHPHSALIAFQQQQQHQQQQARHQQQQARHQQQQARHQQQPPSLPSMAAPALMPPAAQDLSRTCTFYPHQLSPAALPPSLQSKSSSALARSTFSIESIIGGDLNPGPKAAGVPVISRALVTFSSSEAAAALGGNLQPGTVLTNH

Gene
foxd1
Protein
Forkhead box protein D1
Organism
Xenopus tropicalis
Length
329 amino acids
Function
Transcriptional repressor that down-regulates bmp4 signaling in both mesoderm and ectoderm. Regulates mesoderm patterning by repressing ventral mesoderm genes and promoting the expression of dorsolateral genes. Can also neuralize ectodermal cells directly. Inhibits neural crest migration. The transcription factors foxd1 and foxg1 mutually repress each other to pattern the forebrain (By similarity).
Mass
35.831 kDa
Sequence
MTLSSDMSDVLAEETDIDVVGEDDEPRAEEEEDEDLHGDLLPTSPQSSATKDPYKGTGGGGGRSALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELVLREPGHFLPASAYSYGPYSCAYGIQLQPFHPHSALIAFQQQQQQARQQPPSLPPMAAPALMPPAAQDLSRTCTFYPHQLSPAALPPSLQSKSSSALARSTFSIESIIGGDLNPGQCNSPKAAGVPVISRALVTFSSSQAAAALGGTLQPGTVLTNH

Gene
Foxd1
Protein
Forkhead box protein D1
Organism
Rattus norvegicus
Length
101 amino acids
Function
Transcription factor involved in regulation of gene expression in a variety of processes including formation of positional identity in the developing retina, regionalization of the optic chiasm, morphogenesis of the kidney, and neuralization of ectodermal cells (By similarity). Involved in transcriptional activation of PGF and C3 genes (By similarity).
Mass
11.929 kDa
Fragment
single
Sequence
LVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKR