About Services Proteins Contact

FOSTERSB_4073

Gene
FOSTERSB_4073
Protein
Vacuolar membrane protein FOSTERSB_4073
Organism
Saccharomyces cerevisiae (strain FostersB)
Length
314 amino acids
Similarity
Belongs to the PRM5 family.
Mass
34.752 kDa
Sequence
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGATSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSXYLSRRFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAASPFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEEERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAPSMFLDDVLNGREII