Function
Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex, at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation (By similarity). In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum (By similarity).
Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCADLSGSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAAMVKTVSGGRAQSISRRSKVEQLSPEEEEKRRIRRERNKMAAAKCWNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEATTPESEEAFSLPLLNDAEPKTSLEPVKSISNMELKAEPFDDFLFPPSSRPSGSETTARSVPDMDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL