Function
Acts as catalytic subunit of the RNA polymerase II elongator complex, which is a major histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Association with elongating RNAPII requires a hyperphosphorylated state of the RNAPII C-terminal domain (CTD). Elongator binds to both naked and nucleosomal DNA, can acetylate both core and nucleosomal histones, and is involved in chromatin remodeling. It acetylates histones H3, preferentially at 'Lys-14', and H4, preferentially at 'Lys-8'. It functions as a gamma-toxin target (TOT); disruption of the complex confers resistance to Kluyveromyces lactis toxin zymocin (pGKL1 killer toxin). May also be involved in sensitiviy to Pichia inositovora toxin. May be involved in tRNA modification. ELP3 is required for the complex integrity and for the association of the complex with nascent RNA transcript. Independently, ELP3 may be involved in polarized exocytosis. Is required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA.
Sequence
MARHGKGPKTNKKKLAPEKERFIQCCADITLELTDSLTSGTTREINLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMGGTFMSLPKEYREDFIVKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCTQTHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPNVGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTTCRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRNYYGKLGYELDGPYMSKRI