egd1

Nascent polypeptide-associated complex subunit beta

196 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

21.613 kDa

MLNRSPSGTAFDHENGKLTHTYPQCIISPSSSHTRSTPNSYKPDHESTRLTNSLKNRGKGTPRRKVKKVHKSSGADDKKLQATLKKMNVQPIQAIEEVNMFKEDGNVIHFGAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKNQAGAEGKKDDDEDDIPDLVEGENFESNVE

egd1

Nascent polypeptide-associated complex subunit beta

186 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

20.546 kDa

MDQAKLARMQASVRIGTFCSFLWIFEVLESESVFSADGFQAHHLGNVIGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGAEGKKDEDEDDIPDLVEGENFESNVE

egd1

Nascent polypeptide-associated complex subunit beta

183 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

20.478 kDa

MDQAKLARMQASVRIGTFYSFLWIFEVLVSESVFLRMTATNFIDRGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGTEGKKDEDEDDIPDLVEGENFESNVE

EGD1

Nascent polypeptide-associated complex subunit beta

175 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.645 kDa

MDKEKLAKLQSQVRIGGKGTPRRKVVKKSVTSSQGDDRKLQAALKKLGVQPITGVEEVNMFKEDGNVLHFGAPRVQVHAALPSNTLAIYGPGQTKELTELVPGILNQLGPDSLANLRRLAESYQSLTARQAAAAAGSGGEGAGEAKEGEGDDEIPDLVDNFDEAEVKKSDLEELE

EGD1

Nascent polypeptide-associated complex subunit beta

175 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.645 kDa

MDKEKLAKLQSQVRIGGKGTPRRKVVKKSVTSSQGDDRKLQAALKKLGVQPITGVEEVNMFKEDGNVLHFGAPRVQVHAALPSNTLAIYGPGQTKELTELVPGILNQLGPDSLANLRRLAESYQSLTARQAAAAAGSGGEGAGEAKEGEGDDEIPDLVDNFDEAEVKKSDLEELE

EGD1

Nascent polypeptide-associated complex subunit beta

172 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.887 kDa

MADVQERLKKLGASARIGYVLVNFFFSQASIGSRWKTGKGTPRRKMKRAPARSGGDDKKLQQTLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQKADGDKEADDDDIPDLVAGENFEDKVE

egd1

Nascent polypeptide-associated complex subunit beta

167 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.361 kDa

MDQAKLARMQASVRIGNPPSGPRANRNRGKGTPRRKVKKVHKSSGADDKKLQATLKKMNVQPIPAVEEVNMFKEDGNVIHFGNPRVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKNQAGAEGKKDDEEDDIPDLVEGQDFESKVE

EGD1

Nascent polypeptide-associated complex subunit beta

166 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.703 kDa

MVLNQEKLAKLQAASRTGGKGTPRRKMAPKPKGPGGEDPKLQAALKKLQVEPVSGVEEVNMFKEDGNVLHFAAPKVHGLPTSNTFAVYGNGVDKELTELVPGILNQLGPDSLASLRKLAESYQAMNAQHAASQAAAAGTKDDDDVPDVVENFDEADKKETEVDKLD

egd1

Nascent polypeptide-associated complex subunit beta

165 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.219 kDa

MDQAKLARMQASVRIGGKGTPRRKVKKVHKTSGADDKKLQATLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKEERALTVGCEIKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKNQAGEKKDDDEDDIPDLVEGENFEKSVD

egd1

Nascent polypeptide-associated complex subunit beta

164 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

18.06 kDa

MDQAKLARMQASVRIDKSATNPINRGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKSQAGAEGKKDEDEDDIPDLVEGENFESNVE

EGD1

Nascent polypeptide-associated complex subunit beta

162 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.292 kDa

MPVDPAKLAALQKKSGAQSGGKGTPRRPGKKVAGRNISEDEKKLSATLKKFNAQEITGISEVNMFKEDGTVLHFPKVHVEGSVASNTFAISGPSQQKDIAELIPDILPQMGQDALLQLQQAAVQFSKLQEQAKKTAGGPDAAKEAGDDEIPNLVENFEDNVE

EGD1

Nascent polypeptide-associated complex subunit beta

161 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.385 kDa

MPIDQEKLAKLQKLSANNKVGGTRRKLAKKSGTASANKDDSKLQAQLAKLKAVTMDQVEEANFFKDDGSVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQDLFPSIIPQLGSESIDALTQLATQLQNAQAAAPATEGHEAGEKKDNDIPELIEGQSFDADVE

EGD1

Nascent polypeptide-associated complex subunit beta

160 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.583 kDa

MDQAKLARMQASVRIGGKGTPRRKVKKVHKSSGTDDKKLQTALKKLNVQPIQAIEEVNMFKSDGNVIHFSAPKVHASVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKEKGEDGDKKDDDDEDDDDIPELVAGDNFESKTEVE

egd1

Nascent polypeptide-associated complex subunit beta

159 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.57 kDa

MDMEKLKRMQARGGVRTGDGKGTPRRKVKNVHKSTGMDDKKLQTSLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKAEGGEDKKDDDEDDDDIPDLVEGENFEDKVE

egd1

Nascent polypeptide-associated complex subunit beta

159 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.598 kDa

MDMEKLKRMQARGGVRTGDGKGTPRRKVKNVHKSTGMDDKKLQTSLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKAEGGEEKKDDEEDDDDIPDLVEGENFEDKVE

EGD1

Nascent polypeptide-associated complex subunit beta

158 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.391 kDa

MDQAKLARLQQSVRIGKGKGTPRRKTKKVHKSSGTDDKKLQTSLKKLNVQPIQAIEEVNMFKEDGNVIHFAAPKVHASVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQSMQKGEGGEDAKKDDDDDDDEIPDLVEGENFESKVE

EGD1

Nascent polypeptide-associated complex subunit beta

158 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.209 kDa

MPIDQEKLAKLQKLSANNKVGGTRRKFAKKSGSSSKDDSKLQDQLQKLRAVTVDNVQQANFFKDDGTVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQELFPDIIPQMGADAINALTQMASQLQSAQGANQQAAAPEAEGKDIDIPELVEGQTFEADVE

EGD1

Nascent polypeptide-associated complex subunit beta-1

157 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.02 kDa

MPIDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHFNKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHEAKAPADAEKKDEAIPELVEGQTFDADVE

EGD1

Nascent polypeptide-associated complex subunit beta-1

157 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II. Can enhance DNA binding of the GAL4 protein activator.

Belongs to the NAC-beta family.

17.02 kDa

MPIDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHFNKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHEAKAPADAEKKDEAIPELVEGQTFDADVE

EGD1

Nascent polypeptide-associated complex subunit beta

157 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.031 kDa

MPVDPEKLAKLQKSSAKKVGGSRVKAKKNIKTEQDDTKLIEALGKLKATKIEGVEEANFFREDGKVLHFNRVGVQGAPASNTFAFTGYPQEKNITQLIPQILPQLGAENLEILRQLAEQIQAGKTPKDFNTGSANAAADAGGEDIPDLVDQKFDDVE

EGD1

Nascent polypeptide-associated complex subunit beta

157 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.03 kDa

MPVDPEKLAKLQKSTAKKVGGSRVKAKKGVKTEQDDTKLIETLGKLKATKIEGVEEANFFKDDGKVLHFNRVGVQGAPAANTFAFTGYPQEKNITQLIPQILPQLGAENLEILRQLAEQIQAGKNPKDFGAAGEAGATEEANEDIPDLVDQKFDDVE

EGD1

Nascent polypeptide-associated complex subunit beta

156 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.787 kDa

MPIDQEKLAKLQKMSAGNKVGGTRRKQAKKTGSGSAGNKDDTKLHNQLAKLHAVTIDNVAEANFFKDDGKVLHFNKVGVQVAPQHNTSVFYGMAQEKNLQELFPGIISQLGGEAIQALSQLAAQMEKAQANENAGEAKDEAIPELVEGQSFDAEVE

egd1

Nascent polypeptide-associated complex subunit beta

155 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.046 kDa

MDQAKLARMQQSVRIGGKGTPRRKVKKVHKSSGADDKKLQATLKKMNVQPIQAIEEVNMFKEDGNVIHFGAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKNQAGADGKKDDEEDDIPDLVEGENFESNVE

EGD1

Nascent polypeptide-associated complex subunit beta

155 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

17.137 kDa

MDQAKLARLQQSVRIGTGKGTPRRKTKKVHKSSGTDDKKLQTSLKKLNVQPIQAIEEVNMFKEDGNVIHFAAPKVQASVPSNTFAIYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKKEGEAKKEGEEDDEDIPDLVGETFESKVE

EGD1

Nascent polypeptide-associated complex subunit beta

154 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.796 kDa

MPVDPEKLAKLQKASVAKKVGGSRVKAKKNVKTEQDDTKLIEALGKLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQILPQLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEEDIPDLIEGQKFDDVE

EGD1

Nascent polypeptide-associated complex subunit beta

154 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.591 kDa

MPVDPEKLAKLQKAAAKKVGGSRVKAKKVVKTEQDDTKLIEALGKLKATKIENVEEANFFREDGKVLHFNRVGVQGAAASNTFAFTGYPQEKNVTQLIPQILPQLGAENLEILRQLAEQLQAGKAPTELNAGAPAGGDEGIPDLIDGEKFDEVE

EGD1

Nascent polypeptide-associated complex subunit beta

153 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.747 kDa

MSDVQERLKKLGLGARTGTGKGTPRRKVKRAPARSGADDKKLQLALKKLNTQPIQAIEEVNMFKQDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNLQKEKGEDDDEIPDLVEGENFEGEPKVE

EGD1

Nascent polypeptide-associated complex subunit beta

151 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.466 kDa

MPVDPEKLAKLQQGAAKKVGGQRVKAKKVKSEQDDTKLMEALGKLKATKVNAVEEANFFKEDGKVLHFKRVGVQSAAQHNVCAFTGYPQEKDVTQLIPQILPQLGAENLEILRQLAEQIQAGKTPSMGGENAGADEDIPDLIEGQKFDEVE

EGD1

Nascent polypeptide-associated complex subunit beta

150 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.

Belongs to the NAC-beta family.

16.411 kDa

MADVQERLKKLGASARIGTGKGTPRRKVKRAPARSGADDKKLQQSLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPSNTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQQKKDDDDEIPDLVAGESFENKVE