About Services Proteins Contact

ECU03_0940

Gene
ECU03_0940
Protein
Zinc finger C2H2 protein ECU03_0940
Organism
Encephalitozoon cuniculi (strain GB-M1)
Length
196 amino acids
Mass
22.848 kDa
Sequence
MKMNDSSKLKKLYQIEEKKFAERVRRYEDIGHMMDTHQFYLEDVVLKKEEMLYKYISPSQGIAELSEEDSLGFDYEFIHKSVGNKEWRGGISTGEMIKVRKLPCTNLAHGGERNARTSSRMQKTKGGRVYACEIEGCNKKYTSSFGLKYHMKEGHSEEKMNIFKPYVCPFSGCDKKYKNNNGLKYHIKHYHDGQTA