Dusp3

Dual specificity protein phosphatase 3

185 amino acids

Shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2 (By similarity).

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

20.472 kDa

MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDTQEFNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSTVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL

DUSP3

Dual specificity protein phosphatase 3

185 amino acids

Shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2 (By similarity).

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

20.478 kDa

MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP