About Services Proteins Contact

Defb38

Gene
Defb38
Protein
Beta-defensin 38
Organism
Mus musculus
Length
63 amino acids
Function
Synthetic Defb38 kills both Gram-negative (E.coli and P.aeruginosa) and Gram-positive (E.faecium) bacteria.
Similarity
Belongs to the beta-defensin family.
Mass
7.443 kDa
Sequence
MKISCFLLLILSLYFFQINQAIGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY

Gene
Defb38
Protein
Beta-defensin 38
Organism
Rattus norvegicus
Length
63 amino acids
Function
Has antibacterial activity.
Similarity
Belongs to the beta-defensin family.
Mass
7.345 kDa
Sequence
MKISCFLLLVLSLYLFQVNQATDQDTAKCVQKKNVCYYFECPWLSISVSTCYKGKAKCCQKRY