DYS1

Deoxyhypusine synthase

387 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

42.892 kDa

MSDINEKLPELLQDAVLKASVPIPDDFVKVQGIDYSKPEATNMRATDLIEAMKTMGFQASSVGTACEIIDSMRSWRGKHIDELDDHEKKGCFDEEGYQKTTIFMGYTSNLISSGVRETLRYLVQHKMVDAVVTSAGGVEEDLIKCLAPTYLGEFALKGKSLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQDEYVKKHGADCLEANQDVDSPIWTPSKMIDRFGKEINDESSVLYWAHKNKIPIFCPSLTDGSIGDMLFFHTFKASPKQLRVDIVGDIRKINSMSMAAYRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEYDGSDAGARPDEAVSWGKIKAEAKSVKLFADVTTVLPLIVAATFASGKPIKKVKN

DYS1

Deoxyhypusine synthase

385 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

42.442 kDa

MSAANDKLPDILQDAVLKASVPVPDDFVQVKGIDYSAATATDMRASDLVNSMKTMGFQASSLGKACDIIDEMRSWRGKHIDELDEHDRKGQFDDAGYQKTTVFMGYTSNLISSGLRETLRYLVQHKMVDALVATAGGIEEDIIKCLAPTYLGEFSLEGKSLRDQGMNRIGNLLVPNDNYCKFEEWIVPIFDKMLEEQEEYVAKHGKDCLDANTDVDSPIWTPSKLIDRLGKEINDESSVLYWAHKNKIPIFCPAITDGSIGDMLFFHTFKASPKQIRLDIVADIRKINSMSMEASKAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKAEAKSVKIYADVTIVFPLIVAATFANGKPLPKN

DYS1

Deoxyhypusine synthase

385 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

42.442 kDa

MSAANDKLPDILQDAVLKASVPVPDDFVQVKGIDYSAATATDMRASDLVNSMKTMGFQASSLGKACDIIDEMRSWRGKHIDELDEHDRKGQFDDAGYQKTTVFMGYTSNLISSGLRETLRYLVQHKMVDALVATAGGIEEDIIKCLAPTYLGEFSLEGKSLRDQGMNRIGNLLVPNDNYCKFEEWIVPIFDKMLEEQEEYVAKHGKDCLDANTDVDSPIWTPSKLIDRLGKEINDESSVLYWAHKNKIPIFCPAITDGSIGDMLFFHTFKASPKQIRLDIVADIRKINSMSMEASKAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKAEAKSVKIYADVTIVFPLIVAATFANGKPLPKN

DYS1

Deoxyhypusine synthase

382 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

41.984 kDa

MSNNDETVLGHLADHVFKHSGPIPESFVEVKGIDYSKPDAIDMRASDLIKSMKTMGFQASSLGQACDIIDEMRAWRGKHIDELDEYSRKGSFDENGFQKSTIFLGYTSNLISSGLRETLRYLVQHNMVSAIVTTAGGVEEDIIKCLAPTYLGEFTLKGAALRDKGMNRIGNLLVPNNNYCKFEEWIVPILDAMLAEQEAYVAQQGKDCLGVNTDVDSPIWTPSKLCDRLGKEINDESSVLYWAHKNKIPVFCPAITDGSIGDMLFLHTFRASPQQLRLDLVADIRKINSMSMEASQAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKVEAKSVKVYADVTTVFPLIVAATFANGKKN

DYS1

Deoxyhypusine synthase

382 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

41.984 kDa

MSNNDETVLGHLADHVFKHSGPIPESFVEVKGIDYSKPDAIDMRASDLIKSMKTMGFQASSLGQACDIIDEMRAWRGKHIDELDEYSRKGSFDENGFQKSTIFLGYTSNLISSGLRETLRYLVQHNMVSAIVTTAGGVEEDIIKCLAPTYLGEFTLKGAALRDKGMNRIGNLLVPNNNYCKFEEWIVPILDAMLAEQEAYVAQQGKDCLGVNTDVDSPIWTPSKLCDRLGKEINDESSVLYWAHKNKIPVFCPAITDGSIGDMLFLHTFRASPQQLRLDLVADIRKINSMSMEASQAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKVEAKSVKVYADVTTVFPLIVAATFANGKKN

DYS1

Deoxyhypusine synthase

379 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

42.074 kDa

MSNIDGKLPDILSDAVLKQSVPVPDNFVKVEGIDYSKPESRNMRSKDLIKSMATMGFQASSLGKACDIIDEMRSWRGEHRDKLEEHDRKGSFDNDGYQKTTIFMGYTSNLISSGLRETLRFLVQNKMVDAIVATAGGVEEDIIKCLADTYLGEFSLPGKGLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQENYVESQGKDCLDSNFDQDSPVWTPSKLIRRLGKEINDESSVLYWAYKNDIPIFCPAVTDGSIGDMLFFHTFKASPKQLRLDIVSDIRKINSMSMEASRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKADAKSVKVYADATVVFPLVVAATFASE

DYS1

Deoxyhypusine synthase

379 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

42.074 kDa

MSNIDGKLPDILSDAVLKQSVPVPDNFVKVEGIDYSKPESRNMRSKDLIKSMATMGFQASSLGKACDIIDEMRSWRGEHRDKLEEHDRKGSFDNDGYQKTTIFMGYTSNLISSGLRETLRFLVQNKMVDAIVATAGGVEEDIIKCLADTYLGEFSLPGKGLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQENYVESQGKDCLDSNFDQDSPVWTPSKLIRRLGKEINDESSVLYWAYKNDIPIFCPAVTDGSIGDMLFFHTFKASPKQLRLDIVSDIRKINSMSMEASRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAVSWGKIKADAKSVKVYADATVVFPLVVAATFASE

DYS1

Deoxyhypusine synthase

378 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

41.355 kDa

MSGSDKLPGLASDAVLKQSIPVPDSFVEIKGIDYSKDSAYNMKAVDLIESMKNMGFQASSVSQACEIINGMRSWRGKHIDSLPEHERTGEFDDEGYQKSTIFMGYTSNLISSGLRDTLRFLVQHKMVSAIVSSAGGIEEDLIKVLAPTYMGEFSLPGKGLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKCLEEQEEGMKKMGSDGLNADSPACWTPSKLINRLGKEINDESSVLYWAHKNDIPVFCPALTDGSIGDMLFFHTFKASPQQIRLDIVADIRKLNSMSMAASNAGMILLGGGLIKHHICNACLMRNGADYAVYINTGQEFDGSDAGARPDEAISWGKIKAEAKQVKVYADASIVFPLIVAATFASEKPN

DYS1

Deoxyhypusine synthase

378 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

41.355 kDa

MSGSDKLPGLASDAVLKQSIPVPDSFVEIKGIDYSKDSAYNMKAVDLIESMKNMGFQASSVSQACEIINGMRSWRGKHIDSLPEHERTGEFDDEGYQKSTIFMGYTSNLISSGLRDTLRFLVQHKMVSAIVSSAGGIEEDLIKVLAPTYMGEFSLPGKGLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKCLEEQEEGMKKMGSDGLNADSPACWTPSKLINRLGKEINDESSVLYWAHKNDIPVFCPALTDGSIGDMLFFHTFKASPQQIRLDIVADIRKLNSMSMAASNAGMILLGGGLIKHHICNACLMRNGADYAVYINTGQEFDGSDAGARPDEAISWGKIKAEAKQVKVYADASIVFPLIVAATFASEKPN

DYS1

Deoxyhypusine synthase

346 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

37.437 kDa

MSETPNLATEAVLVHSAPVPEDAVPVSGIDFDKPENKNTRAADLVGAMNGMGFQATSLGQACNIIDEMRTWEGVDKEGNPAKTTIFLGYTSNLISSGLRSTLKYLVKNKMVSAIVSSAGGIEEDLIKCLAETYLGDFALKGSVLRETGMNRIGNLLVPNDNYCKFEEWVVPILDTMLEEQEKQGVSWTPSTVIDRLGKEIDNEDSVLYWAHKNQIPVFCPALTDGSLGDMLFFHTFKASPLQLKIDIVADIRKINSMSMAATRAGMIILGGGLVKHHIANACLMRNGADYAVYINTGQEFDGSDAGARPDEAISWGKIKAGAKHVKVYADATLVFPLVVAATFAKE

DYS1

Deoxyhypusine synthase

334 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

37.447 kDa

MDRPQNVKDLARKVKDNLSFSREVRGMDFEKEWDFMAIMRSFETMGFQGSNLYRAVEEIERMKNSKIFFGCTSNIISSGLRDVIATLVKRRHVHVLVITGGGIEEDIIKAFKPTFCADFRLDGAELRDNGLNRIGNLVIPSENYEHLESWLNNIVNDITEGYTAERPRILTPSSFIRILGERIDDESSILYWAAKNDIPVYSPAVVDGSLGDILSFHPRRKMLKLDIVEDVYRINCETIFCGETAAIILGCGVVKHHILNANLFKNGLEHCVLINNAQEFDGSDAGASLDEAVSWGKVKPGTRGVKVFGDATILFPLLVGATFMRKDKDVPKGE

DYS1

Deoxyhypusine synthase

334 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

37.447 kDa

MDRPQNVKDLARKVKDNLSFSREVRGMDFEKEWDFMAIMRSFETMGFQGSNLYRAVEEIERMKNSKIFFGCTSNIISSGLRDVIATLVKRRHVHVLVITGGGIEEDIIKAFKPTFCADFRLDGAELRDNGLNRIGNLVIPSENYEHLESWLNNIVNDITEGYTAERPRILTPSSFIRILGERIDDESSILYWAAKNDIPVYSPAVVDGSLGDILSFHPRRKMLKLDIVEDVYRINCETIFCGETAAIILGCGVVKHHILNANLFKNGLEHCVLINNAQEFDGSDAGASLDEAVSWGKVKPGTRGVKVFGDATILFPLLVGATFMRKDKDVPKGE

dys1

Probable deoxyhypusine synthase 1

317 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

34.596 kDa

MDFEASARDLTTPVKGAKIVPNMSVDELVREYAGCAFGAGRLAEAVDIYYEMLASEKTTKFFGLAGAMTPAGMRGIIADLIRDGHIDVLVTTGANMVHDTVEALGLHHYKGSDCANDIQLRHECIDRIYDVYLPDQHFTDLEEFLQSVYAGLPQEKLSIRQVLTEIGKNLDDDSSILKTAAEMGVPVYCPALQDSVIGLQAWLYKEGNLLHVDAFADMHEFMEICYEAESAGAMLLGGGVPKNYILQSMLVTPKSFDYAIQLTMDRPETGGLSGATLDEAQSWGKVGEDAKSVTVYADATITLPLIVSAVRTRLSKR

dys1

Probable deoxyhypusine synthase 1

317 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

34.422 kDa

MDFGASAKNLSTPVKGAKIVPNMTVDELVKEYAGCAFGAGRLAEAVDIYYEMLASGKTTKFFGLAGAMTPAGMRNIIADLIRDGYIDVLVTTGANMVHDTVEALGLHHYKGSDCANDIQLRHECIDRIYDVYLPDQHFTDLEEFLQGVYSGLPQENLSIRQVLTEIGKNLDDDSSILKTAAEMGVPVYCPALQDSVIGLQAWLYKEGNPLHVDAFADMHEFMDICYGAESAGTMLLGGGVPKNYILQSMLVTPRSFDYAIQLTMDRPETGGLSGATLDEAQSWGKVGEDAKSVTVYADSTITLPLIVSAVRTRLSKR

dys1

Probable deoxyhypusine synthase 1

301 amino acids

Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Belongs to the deoxyhypusine synthase family.

33.348 kDa

MRVTSPEIQRGIKVSELLDMFGSTAFNARRLGEAAKICEEMVKSDSFVFLTLAGAMIPAGMRKIVAGMMQNGFISSLVTTGANIVHEIVESLGIGHEIGSCYVDDTALAEESINRIYDVFVGQEAFERVEEFLSGIIEGLDGIYTTYEFLWEVGKRIPDERSFLRIAAEREIPVFCPTLHDSIAGLHMTIYRKNLQIDFFRDVSRIIDFCFQKRKMGVIVVGGGVPKNFTLQAMLLAEGFDYAVQITTDSPQWGGLSGATLEEAKSWCKLKPDAKAVTVYCDATIALPMLYAYLLDRCGES