DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

160 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

17.004 kDa

MTDAEQTIKNQKTQEAEQSLRVFLRSENATLPTRGSVLSAGYDIYASEEAVIPAQGQGLVGTDISVAVPIGTYGRVAPRSGLAVKHGISTGAGVIDADYRGEVKVVLFNHAQKDFTIQKGDRIAQLVLEKIVMADIKQITAEELDITARGEGGFGSTGKN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

159 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

16.945 kDa

MTSEDQSLKKQKLESTQSLKVYLRSPKGKVPTKGSALAAGYDLYSAEAATIPAHGQGLVSTDISIIVPIGTYGRVAPRSGLAVKHGISTGAGVIDADYRGEVKVVLFNHSEKDFEIKEGDRIAQLVLEQIVNADIKEISLEELDNTERGEGGFGSTGKN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

159 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

16.945 kDa

MTSEDQSLKKQKLESTQSLKVYLRSPKGKVPTKGSALAAGYDLYSAEAATIPAHGQGLVSTDISIIVPIGTYGRVAPRSGLAVKHGISTGAGVIDADYRGEVKVVLFNHSEKDFEIKEGDRIAQLVLEQIVNADIKEISLEELDNTERGEGGFGSTGKN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

157 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

16.857 kDa

MSLKVAFLNENARAPTRGSVHAAGYDLYAAEEKTIPANGRGLVDLGLSMSIPEGTYARIAPRSGLAVKNGLSTGAGVIDYDYRGPVKVMLFNHSTEDFNVTIGDRVAQMILERIVTPEVQVVQTNDLESTERGAGGFGSTGINDEKKRKLDEAEAKE

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

153 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

16.071 kDa

MTDQPAKKVHSAPTLKVQLRSENAIAPTKGSAAAAGYDIYASQDCVIPGRGQGLVATDVSFTVPVGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKIVLFNHSDRDYAVKRGDRVAQLVLERIVDDAEVVVVESLDESSRGEGGFGSTGN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

153 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

16.071 kDa

MTDQPAKKVHSAPTLKVQLRSENAIAPTKGSAAAAGYDIYASQDCVIPGRGQGLVATDVSFTVPVGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKIVLFNHSDRDYAVKRGDRVAQLVLERIVDDAEVVVVESLDESSRGEGGFGSTGN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

148 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

15.534 kDa

MTESLSNSLKVQLRSADAKVPTKGSTTAAGYDIYASQPGVIPARGQGIAKTDISFTVPVGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVGIVLFNHSDKDFQINKGDRVAQLILEKIVEDAEIVVVESLEETQRGAGGFGSTGKN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

147 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

15.307 kDa

MTATSDKVLKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVLFNHSQRDFAIKKGDRVAQLILEKIVDDAQIVVVDSLEESARGAGGFGSTGN

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

144 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

15.85 kDa

MTVSEIRVRKINPRAKIPKRQSEGAAGYDIHSVESGRIPPNGRKSVRTGLAWDVPQSVVGLVFGRSGLALRNWIEVVETCVHPGEDKELVITLVNNGREVFEYEESSRIAQLVFVPVLSCEIDLVESLDLTERGCLGFGSTGMK

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

144 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

15.85 kDa

MTVSEIRVRKINPRAKIPKRQSEGAAGYDIHSVESGRIPPNGRKSVRTGLAWDVPQSVVGLVFGRSGLALRNWIEVVETCVHPGEDKELVITLVNNGREVFEYEESSRIAQLVFVPVLSCEIDLVESLDLTERGCLGFGSTGMK

DUT1

Deoxyuridine 5'-triphosphate nucleotidohydrolase

144 amino acids

This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Belongs to the dUTPase family.

15.314 kDa

MSGNVLKVQLRSEHGIAPTKGSVYAAGYDIYASADYVIPAMGQGMVPTDISFTVPEGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKIILFNHSQKDFEIKRGDRVAQLILEKIVDDAEVVVVESLEDSQRGAGGFGSTGK