Protein
Fe-S cluster assembly protein dre2
Organism
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Function
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex cfd1-nbp35. Electrons are transferred to dre2 from NADPH via the FAD- and FMN-containing protein tah18. Tah18-dre2 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit rnr2.
Similarity
Belongs to the anamorsin family.
Sequence
MAKQTLLLSPPSLSSQPGKLNETLQSYNRNATDLQMLDRLALGLASLPDSTYSTIVILAGGDNSFSESLKLINRQTFNQIIGSLRRGGYIYGQDAVSGVAFDHNEAILAGLIHVGNGKYLKPDIEEMQAVPLRLGRKNDHLAGAPSLEGSAAEHPFPPEVSEGKTASGDNRVAVVGSQKFRENIVSAATMDNNEASDDELINEDNLLDDSELSAPIIQPPECRPKAGKRRRACKDCTCGLAQKLQEEDAVKRADADEQLDAMKLLHDDLAEVDFTVRGKVGSCGNCSLGDAFRCEGCPFIGLPAFQPGEEVRLLNNDVQL