DR1

Uncharacterized protein DR1

759 amino acids

82.565 kDa

MPLTARAGHTLHRLPLSHYWWLLLGRHSLRHVHSYLRLRKGLRLPLPWPEQECLHLHPKPYKFLLRYPCLTRQPHLLQGWPADSSLWFDPKPYHPSADSKLLPLGLITLSAFSMRVSEPTHCSGFHAADPSLSWLTGSSPWLVLLQAPGGSLFCHDVFQGRLYLLSHSVSLFLKTGLRQCEAIYRAPLWRVRPLPSLWTCRDPDTAFLPKLLARTARRGLAAFYALWRLHLGSRSELSHPVLEWERTELVLTDRRRGWPCTHLLSGSESQRVSSSDAGDTWNAATEKAAGGKEEAERGGRQQATDRLASPHLTRGRRDCGRSLQGEEPSAAEDFARCRPLLDELCGEGGWLPFAFLTASPHVCLILTEGGPVLALDLNDTSLWRIADDLELLLRLGSLLLLSGLRLPLRPPSGSGEAARKPGYEKEEGRGRATTASATAATSPRRPTRPRGVTEKGRVTTGDVPFSAHPESEEQTDGHHGRQESGHGDQRGGDGRGHRDDGARRHANDETEPQQRGEHEDGEQTDSGREEDAQESEVARRDEKGTEQGGSGRSCGRATQTYGGRGEHGAWSSIPLSVPRPDPRVWVPPPHLLFPSPLPSITPVEDEPSARPRCPPGPAEEPSKCSPCPPCPSPDAPQSAVPRLSALSVPSPSTARVRFSLSSLSSSSSSSSSSSPSYSPSPLSPPSPVSPSSPRSPFISPIRSPGLRAKPWVSSGHPVAFPPAPSSAPPFSKRVPSVPSSASPSAPCIGRSRPPSAQTA

dr1

Protein Dr1 homolog

178 amino acids

Involved in transcriptional regulation. Component of the NC2 complex which represses RNA polymerase II transcription through binding to tbp and thereby inhibiting the assembly of the preinitiation complex (By similarity).

Belongs to the NC2 beta/DR1 family.

20.052 kDa

MGDKNDKEDNLSLPKATVSKLIKEMLPQDVKCSNETRDLILECCVEFIHLISSEANDICGREQKRTIAAEHVIKALTELGFSDYTQKVSDVYDKHKLEVSTKSKSSKKFENLGKPTEQLIREQQLLFAKARSAFQASPEAQQLQQLQQQQQQQQGGLQAPSVQQQTDINTTTTSTIQK

DR1

Protein Dr1

176 amino acids

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own (By similarity).

Belongs to the NC2 beta/DR1 family.

19.444 kDa

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEDDEDDI

DR1

Protein Dr1

176 amino acids

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Belongs to the NC2 beta/DR1 family.

19.444 kDa

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI

Dr1

Protein Dr1

176 amino acids

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity).

Belongs to the NC2 beta/DR1 family.

19.431 kDa

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASASTQAGSSQDEEDDDDI

Dr1

Protein Dr1

176 amino acids

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity).

Belongs to the NC2 beta/DR1 family.

19.43 kDa

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEDDDDDI

DR1

Protein Dr1 homolog

159 amino acids

Belongs to the NC2 beta/DR1 family.

17.942 kDa

MDPMDIVGKSKEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNDVCNKEDKRTIAPEHVLKALQVLGFGEYIEEVYAAYEQHKYETMQDTQRSVKWNPGAQMTEEEAAAEQQRMFAEARARMNGGVSVPQPEHPETDQRSPQS