DNA-M

Movement and RNA silencing protein

117 amino acids

Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Begomovirus genome is shuttled out of nucleus by Nuclear shuttle protein (NSP) and the movement protein transports the DNA-NSP complex to cell plasmodesmata and facilitates further movement across the cell wall. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

13.739 kDa

MALTTERVKLFFEWFLFFGAIFIAITILYILLVLLFEVPRYIKELVRCLVEYLTRRRVWMQRTQLTEATGDVEIGRGIVEDRRDQEPAVIPHVSQVIPSQPNRRDDQGRRGNAGPMF

DNA-M

Putative movement protein

114 amino acids

May transport viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (By similarity).

Belongs to the nanovirus movement protein family.

12.875 kDa

MADTGYYAGYQDDVDVDEQKRHQALYLIGIILLVTVCLTVLWVCIMLACYVPGFLKKTLEAWLNSSSLMKRRVASTLTRTPFEATGPERERNWEARRQSTTVNPASQPNTGSVF

DNA-M

Putative movement protein

114 amino acids

May transport viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (By similarity).

Belongs to the nanovirus movement protein family.

12.882 kDa

MADTGYYAGYQDDVDVDEHKRHQALYLIGIILLVTVCLIVLWVCIMLACYVPGFLKKTLEAWLNSSSLMKRRVASTLTRTPFEATGPERERNWDARRQSTTVNPASQPNTGSVF

DNA-M

Putative movement protein

112 amino acids

May transport viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (By similarity).

Belongs to the nanovirus movement protein family.

12.699 kDa

MDSGDGYNTYSYEEGAGDAKKEVLYKIGIIMLCIVGIVVLWVLIILCCAVPRYAKSTMDAWLSSSSIMKRKMASRITGTPFEETGPHRERRWAERRTEATNQNNNDNVNRFS

DNA-M

Putative movement protein

112 amino acids

May transport viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier (By similarity).

Belongs to the nanovirus movement protein family.

12.677 kDa

MADPVYYQGYQDDGDIDAQKRHQALYLIGIIILIMVCIIILWVCIMLACYIPGFLKKTMEAWLSSSSMMKRRVAATITRTPFEATGPERERNWDARRQTNAASSQPSNGGVF