DIR1

Dirigent protein 1

182 amino acids

Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.

Belongs to the plant dirigent protein family.

20.131 kDa

MAKRFLLLLPLLSSILLLAVSVTAYSTTTPYQGYKPEKFTHLHFYFHDVISGDKPTAVKVAEARPTTTLNVKFGVIMIADDPLTEGPDPSSKEVGRAQGMYASTAMKDIVFTMVFNYVFTAGEFNGSTIAVYGRNDIFSKVRELPIIGGTGAFRFARGYALPKTYKIVGLDAVVEYNVFIWH

DIR1

Putative lipid-transfer protein DIR1

102 amino acids

Putative lipid transfer protein required for systemic acquired resistance (SAR) long distance signaling. May interact with a lipid-derived molecule to promote long distance signaling associated with SAR. Together with AZI1, required for glycerol-3-phosphate- (G3P) and azelaic acid- (AA) induced systemic acquired resistance (SAR). Component of plant systemic immunity involved in priming defenses in a AA-dependent manner, by modulating production and/or translocation of a mobile signal(s) during SAR.

Belongs to the A9/FIL1 family.

10.702 kDa

MASKKAAMVMMAMIVIMAMLVDTSVAIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC