About Services Proteins Contact

DEFB128

Gene
DEFB128
Protein
Beta-defensin 128
Organism
Homo sapiens
Length
93 amino acids
Function
Has antibacterial activity.
Similarity
Belongs to the beta-defensin family.
Mass
10.65 kDa
Sequence
MKLFLVLIILLFEVLTDGARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV

Gene
DEFB128
Protein
Beta-defensin 128
Organism
Hylobates lar
Length
93 amino acids
Function
Has antibacterial activity.
Similarity
Belongs to the beta-defensin family.
Mass
10.663 kDa
Sequence
MKLFLVLIILLFEVLTDGARLKKCFNNITGYCRKKCKVGERYEIGCLSGKLCCVNDEEEKKHVSFKKPHQHSGEKLSVQQDYIILPTITIFAV

Gene
DEFB128
Protein
Beta-defensin 128
Organism
Macaca fascicularis
Length
93 amino acids
Function
Has antibacterial activity.
Similarity
Belongs to the beta-defensin family.
Mass
10.634 kDa
Sequence
MKLFLVLIILLFEVLTDGARLKKCFNNVTGYCRKKCKVGEIHEIGCLSGKLCCVNDEENKKHVPFKKPHQQPVEKLSVQQDYVILPTITIFTV

Gene
DEFB128
Protein
Beta-defensin 128
Organism
Pongo pygmaeus
Length
93 amino acids
Function
Has antibacterial activity.
Similarity
Belongs to the beta-defensin family.
Mass
10.728 kDa
Sequence
MKLFLVLIILLFEVLTDGARLKKCFNNVTGYCRKKCKVGERYEIGCLSGKLCCINYEEEKEHVSFKKPHQHSGEKLSVQQDYIILPTVTIFTV