About Services Proteins Contact

DDO

Gene
DDO
Protein
D-aspartate oxidase
Organism
Bos taurus
Length
341 amino acids
Similarity
Belongs to the DAMOX/DASOX family.
Mass
37.66 kDa
Sequence
MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTPIQKQKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMTKDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSNVTLGGTRQKGDWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQDSRRLPVVHHYGHGSGGIAMHWGTALEATRLVNECVQVLRTPAPKSKL

Gene
DDO
Protein
D-aspartate oxidase
Organism
Homo sapiens
Length
341 amino acids
Function
Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
Similarity
Belongs to the DAMOX/DASOX family.
Mass
37.535 kDa
Sequence
MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL

Gene
Ddo
Protein
D-aspartate oxidase
Organism
Mus musculus
Length
341 amino acids
Function
Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
Similarity
Belongs to the DAMOX/DASOX family.
Mass
37.546 kDa
Sequence
MDTVCIAVVGAGVIGLSTAACISQLVPGCTVTVISDRFTPDTTSNVAAGMLIPHTCADTPVPTQKRWFRETFEHLSEIAKSAEAADAGVHLVSGWQIFRSVPAEEVPFWADVVLGFRKMTEAELKRFPQYVFGQAFTTLKCETSAYLPWLERRIKGSGGLLLTRRIEDLWELQPSFDIVVNCSGLGSRRLVGDPMISPVRGQVLQARAPWVKHFIRDGGGLTYVYPGMSYVTLGGTRQKGDWNRSPDAELSREIFSRCCTLEPSLHRAYDIKEKVGLRPSRPGVRLQKEILVRGQQTLPVVHNYGHGSGGISVHWGSALEATRLVMECIHTLRTPASLSKL

Gene
DDO
Protein
D-aspartate oxidase
Organism
Sus scrofa
Length
341 amino acids
Function
Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
Similarity
Belongs to the DAMOX/DASOX family.
Mass
37.316 kDa
Sequence
MDTVRIAVVGAGVMGLSTAVCIFKLVPGCSITVISDKFTPETTSDVAAGMLIPPVYPDTPIHKQKQWFKDTFDHLFAIANSAEAKDAGVLLVSGWQIFQSAPTEEVPFWADVVLGFRKMTKNELKKFPQHVCGQAFTTLKYEGPTYLPWLEKRVKGSGGLVLTRRVEDLWELHPSFDIVVNCSGLGSKQLVGDMDIFPVRGQVLKVQAPWVKHFIRDGSGLTYIYPGLANVTLGGTRQKGDWNLSPNAEISKQILSRCCALEPSLRGACDIREKVGLRPSRPGVRLEKELLVQGSQRLPVVHNYGHGSGGIAMHWGTALEAARLVSECVQALRTPAPKSKL