Function
Sulfur-rich seed storage protein that remains undegraded at germination (PubMed:11406286). The uncleaved form exhibits some inhibitory activity against GH11 xylanase from T.longibrachiatum, more at pH 7 than at pH 5.3, but not against GH12 xyloglucan-specific endoglucanase (XEG) from A.aculeatus (PubMed:26741537). Binds to model phospholipid membranes containing dimyristoyl phosphatidylglycerol (DMPG), dioleoyl phosphatidic acid (DOPA) or mixture of dimyristoyl phosphatidylcholine and dimyristoyl phosphatidylglycerol (DMPC:DMPG), or mixture of dioleoyl phosphatidic acid and dioleoyl phosphatidylcholine (DOPC:DOPA) (PubMed:30312772).
Sequence
MAKNMAPILHILVISLSYSFLFVTSSSQNSQSLYHNSQPTSSSKPNLLVLPIQQDASTKLHWGNILKRTPLMQVPVLLDLNGKHLWVTCSQHYSSSTYQAPFCHSTQCSRANTHQCFTCTDSTTSRPGCHNNTCGLISSNPVTQESGLGELAQDVLALHSTHGSKLGSLVKIPQFLFSCAPTFLTQKGLPNNVQGALGLGHAPISLPNQLFSHFGLKRQFTMCLSSYPTSNGAILFGDINDPNNNNYIHNSLDVLHDMVYTPLTISKQGEYFIQVSAIRVNKHMVIPTKNPSMFPSSSSSSYHESSEIGGAMITTTNPYTVLRHSIFEVFTQVFANNVPKQAQVKAVGPFGLCYDTKKISGGVPSVDLIMDKSDVVWRISGENLMVQAQDGVSCLGFVDGGVHTRAGIALGTHQLEENLVVFDLARSRVGFNTNSLKSHGKSCSNLFDLNNP