About Services Proteins Contact

CYCF1-3

Gene
CYCF1-3
Protein
Putative cyclin-F1-3
Organism
Oryza sativa subsp. japonica
Length
389 amino acids
Similarity
Belongs to the cyclin family. Cyclin F subfamily.
Mass
42.659 kDa
Sequence
MLAAASRTTMLGIPDSGQLVAALTGLGEEDEHIRDAGRVGTPHTYGSFLPIYGDLPPLSVTVVQETLPLPEGGDHPVPPKKTIDVAPLLPEHADQPVVTNNSATTRPQLCAPYDDDIEATLRAMETNPAERPSPYFLETTQGGRMTALVRASMIAFMDEFSRFYELADGTLQRAAYFLDRYLSVTPESDDVLQLRLVGATAVFLAAKYEDQYTLRKIDASMVAARCGYTSETRHKMVSCMETEILAALDYNLSGPTASTFVQHFTRYYGDGKEEELLKEAAHRFTDGSLLTYGFHRYLPSVVAASAIFLARLHVLGHEPWSRDLAELTGYEAIDLMGCVCDMYSQIACPRFAPFQVCEHVPDSSHVSADHEEVESSLQFVSAEHGNPAG

Gene
CYCF1-3
Protein
Putative cyclin-F1-3
Organism
Oryza sativa subsp. japonica
Length
389 amino acids
Similarity
Belongs to the cyclin family. Cyclin F subfamily.
Mass
42.659 kDa
Sequence
MLAAASRTTMLGIPDSGQLVAALTGLGEEDEHIRDAGRVGTPHTYGSFLPIYGDLPPLSVTVVQETLPLPEGGDHPVPPKKTIDVAPLLPEHADQPVVTNNSATTRPQLCAPYDDDIEATLRAMETNPAERPSPYFLETTQGGRMTALVRASMIAFMDEFSRFYELADGTLQRAAYFLDRYLSVTPESDDVLQLRLVGATAVFLAAKYEDQYTLRKIDASMVAARCGYTSETRHKMVSCMETEILAALDYNLSGPTASTFVQHFTRYYGDGKEEELLKEAAHRFTDGSLLTYGFHRYLPSVVAASAIFLARLHVLGHEPWSRDLAELTGYEAIDLMGCVCDMYSQIACPRFAPFQVCEHVPDSSHVSADHEEVESSLQFVSAEHGNPAG