Organism
Arabidopsis thaliana
Function
Involved in the control of the cell cycle at the G1/S (start) transition. Activates the G1/S phase transition in response to cytokinin hormone signal, but declines in response to sucrose starvation leading to G1 arrest. Involved in the induction of mitotic cell division. Plays an important role in the switch from cell proliferation to the final stages of differentiation during plant development. May not be involved in the activation of cell cycle in the root apical meristem (RAM) in the early phase of seed germination. Promotes divisions in the guard cells (GCs) after the guard mother cells (GMC) symmetric division (PubMed:24687979).
Similarity
Belongs to the cyclin family. Cyclin D subfamily.
Sequence
MAIRKEEESREEQSNSFLLDALYCEEEKWDDEGEEVEENSSLSSSSSPFVVLQQDLFWEDEDLVTLFSKEEEQGLSCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAITYLDKFICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMELLILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKCHRLLLSVISDSRFVGYLPSVVAAATMMRIIEQVDPFDPLSYQTNLLGVLNLTKEKVKTCYDLILQLPVDRIGLQIQIQSSKKRKSHDSSSSLNSPSCVIDANPFNSDESSNDSWSASSCNPPTSSSSPQQQPPLKKMRGAEENEKKKPILHLPWAIVATP