CXCR1

C-X-C chemokine receptor type 1

355 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

40.622 kDa

MEVNVWNMTDLWTWFEDEFANATGMPPVEKDYSPCLVVTQTLNKYVVVVIYALVFLLSLLGNSLVMLVILYSRSNRSVTDVYLLNLAMADLLFALTMPIWAVSKEKGWIFGTPLCKVVSLVKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFICLGIWALSLILSLPFFLFRQVFSPNNSSPVCYEDLGHNTAKWRMVLRILPHTFGFILPLLVMLFCYGFTLRTLFQAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTHVIQETCQRRNDIDRALDATEILGFLHSCLNPIIYAFIGQNFRNGFLKMLAARGLISKEFLTRHRVTSYTSSSTNVPSNL

CXCR1

C-X-C chemokine receptor type 1

351 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity (By similarity).

Belongs to the G-protein coupled receptor 1 family.

39.981 kDa

MSNITDPQMWDYDGDPNFTGMPPIDEDYRPCRLETETLNKYVVIVTYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAVSKVNGWIFGTLLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLSCWGLSMILSLPFFLFRQAYHPKNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFALCTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQLIKESCERRNDIGWALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHHVTSYTSSSVNVSSNL

CXCR1

C-X-C chemokine receptor type 1

351 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity (By similarity).

Belongs to the G-protein coupled receptor 1 family.

40.048 kDa

MWNITDPQGWDYDGDLYFTGMPPIDEDFSPCKLETETLNKYVVIITYALVFLLSLLGNSLVMLVILYSRVGRSVTDIYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCVGCWGLSMILSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLLVMLFCYGFTLHTLFKAHMGQKHRAMRVVFAVVLIFLLCWLPYNLVLFTDTLMRTQLIKESCERRKDISKALEATEILGFFHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHHVTSYTSSSVNVSSNL

CXCR1

C-X-C chemokine receptor type 1

351 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity (By similarity).

Belongs to the G-protein coupled receptor 1 family.

39.811 kDa

MSNATDPQMGDDDYDLNFTGMPPTDEDYSPCRLETQSLNKYVVIVTYALVFLLSLLGNSLVMLVILYRRVGRSVTDVYLLNLAMADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLIQKRHSVKFVCLSCWGLSVILSLPFFLFRQAYHPNNSTPVCYEVLGNDTAKWRMVLRILPHTFGFTLPLLIMLFCYGFTLHTLFKAHIGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTHLIKESCERRNDIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILATHGLVSKEFLARHHVTSYTSSSVNVSSNL

Cxcr1

C-X-C chemokine receptor type 1

351 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

40.032 kDa

MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSKLKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCVGIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLTMLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDTCERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRRVAFHTSLTAIY

CXCR1

C-X-C chemokine receptor type 1

350 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.

Belongs to the G-protein coupled receptor 1 family.

39.79 kDa

MSNITDPQMWDFDDLNFTGMPPIDEDYSPCRLETETLNKYVVIITYALAFLLSLLGNSLVMLVILYSRGGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMILSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNVSLALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

CXCR1

C-X-C chemokine receptor type 1

350 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.

Belongs to the G-protein coupled receptor 1 family.

39.791 kDa

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

CXCR1

C-X-C chemokine receptor type 1

350 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.

Belongs to the G-protein coupled receptor 1 family.

39.818 kDa

MSNITDPQMWDFDDLNFTGMPPTDEGYSPCRLETETLNKYVVIITYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Cxcr1

C-X-C chemokine receptor type 1

349 amino acids

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

39.945 kDa

MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLLGNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSLLKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFRQAYKPYRSGTVCYEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMRQKRRAMWVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGFSHSCLNPVIYAFVGQSFRHEFLKILANLVHKEVLTHHSASFRTSLTTIY