About Services Proteins Contact

CTN_1413

Gene
CTN_1413
Protein
UPF0173 metal-dependent hydrolase CTN_1413
Organism
Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E)
Length
226 amino acids
Similarity
Belongs to the UPF0173 family.
Mass
24.691 kDa
Sequence
MKITFLGHAAVLVEGKKNLIIDPFITGNPACPVKLEDLPKIDYILVTHGHGDHLGDAVEIAKKNDAIVISNYEICQYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGENIIYGGNPGGFLITLEGKKIYHAGDTGLTKDMELLKEENVDVAFLPIGGNFVMDVEDAIRAVSMISPRKVVPMHYGTWEIIFADVELFKKKVEEMGVECVILEPGESLEL