About Services Proteins Contact

CTF1

Gene
ctf1
Protein
Cleavage and termination factor 1
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
363 amino acids
Function
Component of the cleavage factor I (CF I) involved in pre-mRNA 3'-end processing.
Mass
39.963 kDa
Sequence
MSMTAGNVVFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRKLNNSELGPRKIRVEFPSNDPRRNQSYEYTERTDRYMEQQNAHESSYNSRFIPPVLHSTSSLPASQGGGMPSPAIYSSSMATNLNKNINSTSVPAYNFHNSMTSDFDSASQPHTDAYNARTFQYNKSSQNKGDYTSGTSISNPTSIPLAPSVVQVLSTFSAQELLNMLSKLQTVVHIAPEEARRLLIANPALPYAAFQAMLLMNLVDANVLQQVVVAVKNKNMHQPASATSSPPSVPQKIPSSNHKSQQANGSDQGNEGKRMALIQQLLALTPEQINALPPAQRDQILSIRRQHFRQ

Gene
Ctf1
Protein
Cardiotrophin-1
Organism
Mus musculus
Length
203 amino acids
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Similarity
Belongs to the IL-6 superfamily.
Mass
21.509 kDa
Sequence
MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

Gene
Ctf1
Protein
Cardiotrophin-1
Organism
Rattus norvegicus
Length
203 amino acids
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Similarity
Belongs to the IL-6 superfamily.
Mass
21.439 kDa
Sequence
MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA

Gene
CTF1
Protein
Cardiotrophin-1
Organism
Homo sapiens
Length
201 amino acids
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Similarity
Belongs to the IL-6 superfamily.
Mass
21.227 kDa
Sequence
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA