About Services Proteins Contact

CT1945

Gene
CT1945
Protein
Putative arsenical pump-driving ATPase
Organism
Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Length
405 amino acids
Function
Anion-transporting ATPase. Catalyzes the extrusion of arsenite (By similarity).
Similarity
Belongs to the arsA ATPase family.
Mass
45.848 kDa
Sequence
MRILTFTGKGGVGKTSVSAATAVRLSEMGHRTLVLSTDPAHSLSDSFNIQLGAEPTKIKENLHAIEVNPYVDLKQNWHSVQKYYTRIFMAQGVSGVMADEMTILPGMEELFSLLRIKRYKSAGLYDALVLDTAPTGETLRLLSLPDTLSWGMKAVKNVNKYIVRPLSKPLSKMSDKIAYYIPPEDAIESVDQVFDELEDIREILTDNVKSTVRLVMNAEKMSIKETMRALTYLNLYGFKVDMVLVNKLLDAQENSGYLEKWKGIQQKYLGEIEEGFSPLPVKKLKMYDQEIVGVKSLEVFAHDIYGDTDPSGMMYDEPPIKFVRQGDVYEVQLKLMFANPVDIDVWVTGDELFVQIGNQRKIITLPVSLTGLEPGDAVFKDKWLHIPFDLEKQGQHHRTREYNKA