About Services Proteins Contact

CST9LP1

Gene
CST9LP1
Protein
Putative cystatin-9-like protein CST9LP1
Organism
Homo sapiens
Length
147 amino acids
Similarity
Belongs to the cystatin family.
Mass
17.316 kDa
Sequence
MWSLPPSRALSCAPLLLLFSFQFLVTYAWRFQEEEEWNDQKQIAVYLPPTLEFAVYTFNKQSKDWYAYKLVPVLASWKEQGYDKMTFSMNLQLGRTMCGKFEDDIDNCPFQESPELNNTCTCFFTIGIEPWRTRFDLWNKTCSGGHS