About Services Proteins Contact

CSLG2

Gene
CSLG2
Protein
Cellulose synthase-like protein G2
Organism
Arabidopsis thaliana
Length
722 amino acids
Function
Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.
Similarity
Belongs to the glycosyltransferase 2 family. Plant cellulose synthase-like G subfamily.
Mass
82.12 kDa
Sequence
MEPQRKHSTALHTCHPCRRTIPYRIYAVFHTCGIIALMYHHVHSIVNANNTLITCLLLLSDIVLAFMWATTTSLRLNPIHRTEYPEKYAAKPEDFPKLDVFICTADPYKEPPMMVVNTALSVMAYEYPSHKISVYVSDDGGSSLTLFALMEAAKFSKHWLPFCKNNNVQDRSPEVYFSSKSHSSSDEAENLKMMYEDMKSRVEHVVESGKVETAFIACDQFSCVFDLWTDKFTRHDHPTIIMVLQHNETEMMPNLIYVSREKSKVSPHHFKAGALNTLLRVSAVMTNSPIILTLDCDMYSNNPTTPLHALCYLSDPKINFDLGFVQFPQKFQGVNKNDIYASELKRPFDINTVGFDGLMGPVHMGTGCFFNRRAFYGPPTTLILPEIETFGPNRIADKPIKAQDILALAHDVAGCNYECNTNWGSKIGFRYGSLVEDYFTGFMLHCEGWRSIFCSPTKAAFYGDSPKCLTDVIGQQIRWSVGLLEVAFSRYNPLTYGIKPLSLLMSLGYCHYAFWPFWCIPLVVYGILPQVALIHGVSVFPKASDPWFWLYIILFLGGYAQDLSDFLLEGGTYRKWWNDQRMWMVRGLSSFFFGFTEFTLKTLNLSTQGYNVTSKSNDDNEQMKRYEQEIFDFGPSSSMFLPITTVAIMNLLAFMRGLYGIFTWGEGPVLELMLASFAVVNCLPIYEAMVLRIDDGKLPKRICFLAGLLSFVLTGSGYFFLK