About Services Proteins Contact

CSH2

Gene
CSH2
Protein
Chorionic somatomammotropin hormone 2
Organism
Bos taurus
Length
238 amino acids
Similarity
Belongs to the somatotropin/prolactin family.
Mass
27.714 kDa
Sequence
MAPAPSFRGHQWTYNPVRGSCLLLLLVVSNLLLCQGISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC

Gene
CSH2
Protein
Chorionic somatomammotropin hormone 2
Organism
Bos taurus
Length
238 amino acids
Similarity
Belongs to the somatotropin/prolactin family.
Mass
27.714 kDa
Sequence
MAPAPSFRGHQWTYNPVRGSCLLLLLVVSNLLLCQGISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC

Gene
CSH2
Protein
Chorionic somatomammotropin hormone 2
Organism
Homo sapiens
Length
217 amino acids
Function
Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Similarity
Belongs to the somatotropin/prolactin family.
Mass
24.994 kDa
Sequence
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Gene
CSH2
Protein
Chorionic somatomammotropin hormone 2
Organism
Homo sapiens
Length
217 amino acids
Function
Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Similarity
Belongs to the somatotropin/prolactin family.
Mass
24.994 kDa
Sequence
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF