CPR1

F-box protein CPR1

413 amino acids

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Regulates negatively both salicylic acid (SA)-dependent and SA-independent defense signaling.

47.259 kDa

MATIPMDIVNDIFLRLPAKTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMILLRGALRLYSVDLDSLDSVSDVEHPMKRGGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLPPSSIDLPDGSSTRGYVFYGLGYDSVSDDYKVVRMVQFKIDSEDELGCSFPYEVKVFSLKKNSWKRIESVASSIQLLFYFYYHLLYRRGYGVLAGNSLHWVLPRRPGLIAFNLIVRFDLALEEFEIVRFPEAVANGNVDIQMDIGVLDGCLCLMCNYDQSYVDVWMMKEYNVRDSWTKVFTVQKPKSVKSFSYMRPLVYSKDKKKVLLELNNTKLVWFDLESKKMSTLRIKDCPSSYSAELVVSSLVLGCKGDLNNIKYRKEQQAKEAREAKIMQNTKRRDDFLSKGFKLVL

CPR1

Probable proteasome subunit beta type-4

224 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1B family.

25.239 kDa

MECSFGITGKDYVILASDMGAGRSIVRMKSDENKLKTLGPHLAMAFSGEPGDTNNFAEYIERNMRLYNIRNHFPLLPPAASAWVRRTLAEAIRSRHPYAVNLLLGGFDTTTSKPHLYWIDYLGTKAIVPYAAHGMGVYVSLSTMDKWWYEDMDKKEGVDLLRKCIDETEKRLTIKFDFNCILIDKNGIHKVDLSQADPIANIQEHPQETEVEAPHPPIEVGISA

CPR1

Probable proteasome subunit beta type-4

224 amino acids

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity).

Belongs to the peptidase T1B family.

25.239 kDa

MECSFGITGKDYVILASDMGAGRSIVRMKSDENKLKTLGPHLAMAFSGEPGDTNNFAEYIERNMRLYNIRNHFPLLPPAASAWVRRTLAEAIRSRHPYAVNLLLGGFDTTTSKPHLYWIDYLGTKAIVPYAAHGMGVYVSLSTMDKWWYEDMDKKEGVDLLRKCIDETEKRLTIKFDFNCILIDKNGIHKVDLSQADPIANIQEHPQETEVEAPHPPIEVGISA

CPR1

Peptidyl-prolyl cis-trans isomerase

172 amino acids

PPIases accelerate the folding of proteins. They catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the cyclophilin-type PPIase family.

19.047 kDa

MAKEASGNVYFDVYANEESLGRIVMKLEDDIVPKTAKNFRTLCERPKGEGYKGSTFHRIIPGFMVQGGDYTAHNGTGGRSIYGEKFPDENFELKHTKEGILSMANCGAHTNGSQFFITLGKTQWLDEKHVVFGEVVEGMDVVHKIAKYGSESGQVKKGYRIEIRDCGVLGSN

CPR1

Peptidyl-prolyl cis-trans isomerase

162 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Involved in histone deacetylase complexes, suggesting a function in chromatin. Imports fructose-1,6-bisphosphatase (FBPase) into the intermediate vacuole import and degradation (Vid) vesicles. Regulates the meiotic gene program via the Set3C histone deacetylase complex to promote efficient sporulation, and the prolyl-isomerase activity is required for this function.

Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.

17.391 kDa

MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL