COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.228 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMTVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Copz1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

19.369 kDa

MESCPSVKNILLLDSEGKRVAVKYYTDDWPTLSAKLAFEKSVFVKTQKATAGAEAEIVMFDGHIVVYKFIQDLHFFVTGGEEENELILASVLQGFTDAVDIILRNNVDKRTALENLDLILLCLDEIVDGGIVLETEGSVIAEKVSAHGIEGATSLAEQTIVQALTTAREHLTKSLLM

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.228 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMTVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Copz1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

19.369 kDa

MESCPSVKNILLLDSEGKRVAVKYYTDDWPTLSAKLAFEKSVFVKTQKATAGAEAEIVMFDGHIVVYKFIQDLHFFVTGGEEENELILASVLQGFTDAVDIILRNNVDKRTALENLDLILLCLDEIVDGGIVLETEGSVIAEKVSAHGIEGATSLAEQTIVQALTTAREHLTKSLLM

COPZ1

Coatomer subunit zeta-1

177 amino acids

The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.

Belongs to the adaptor complexes small subunit family.

20.198 kDa

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR