About Services Proteins Contact

COPRO5265_1289

Gene
COPRO5265_1289
Protein
8-amino-7-oxononanoate synthase
Organism
Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT)
Length
393 amino acids
Function
Catalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide.
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. BioF subfamily.
Mass
43.172 kDa
Sequence
MPVEEFERELNERREQGLYVTIRKIGSPQGAWIIVDGKKVLNLSSNNYLGFANHPRLKEAAKKGIDDYGAGPAAVRTIAGDQLPQEKLEEMLAEFKGAEAAVLYQSGFCANLGTIPALVGEGDAIFSDELNHASIIDGCRLSRAKIIRYPHLNVQTLEELLKQERQNYKKAMIITDGVFSMDGDIAPMDKLADLADKYQCILYVDDAHGEGVLGDSGRGIVDYFGLQGRVDVEIGTLSKAFGVVGGFAAGSKLLAELLKQKARPLLFSSAPTAADVYASMEAVRILQESDELVKKLWENANYFKEHMRKAGFDLGNSQTPITPVMIGDEITTQEFSKKLFERNVFAQAISYPTVPKGKARMRVMISATHSRDDLDFAVEQFTAVGKELGVIQS