COA6

Cytochrome c oxidase assembly factor 6 homolog

125 amino acids

Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.

Belongs to the cytochrome c oxidase subunit 6B family.

14.116 kDa

MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS

COA6

Cytochrome c oxidase assembly factor 6

104 amino acids

Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.

Belongs to the cytochrome c oxidase subunit 6B family.

12.445 kDa

MGLFSFDGGKKESQPPNTRSQRKLCWESRDAFFQCLDKADILDAMDPKNSKSIKSHCKVENEKFEENCAHSWIKYFKEKRVIDFKREQTIKRIEQEAKQRERNQ

COA6

Cytochrome c oxidase assembly factor 6 homolog

79 amino acids

Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.

Belongs to the cytochrome c oxidase subunit 6B family.

9.417 kDa

MAAPTMKERQACWGARDEYWKCLDENTEDASKCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGDFQPSKMTAKS

Coa6

Cytochrome c oxidase assembly factor 6 homolog

79 amino acids

Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.

Belongs to the cytochrome c oxidase subunit 6B family.

9.298 kDa

MAAPSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLKFKEKFEAGGFQSSQSTENS