Protein
Carbohydrate sulfotransferase 4
Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within mucin-associated glycans that ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of SELL ligand sialyl 6-sulfo Lewis X on SELL counter-receptors SPN/CD43, GLYCAM1 and MADCAM1. Also involved in biosynthesis of SELL ligand recognized by MECA-79 antibody. Plays a central role in lymphocyte trafficking during chronic inflammation. Has a catalytic preference for core 2-branched mucin-type O-glycans. Can use GlcNAcbeta1-6[Galbeta1-3]GalNAc-pNP (core 2), GlcNAcbeta1-6ManOMe and GlcNAcbeta1-2Man oligosaccharide structures as acceptors. Has also activity toward core 3 of GlcNAcbeta1-3GalNAc-pNP. Its substrate specificity may be influenced by its subcellular location.
Similarity
Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
Sequence
MMLLKKGRLLMFLGSQVIVVALFIHMSVHRHLSQREESRRPVHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFTSSTAWKLHMAVRDLLRSVFLCDMSVFDAYMNPGPRKQSSLFQWEQSRALCSAPVCDFFPAHEISSPKHCKLLCGQQPFDMVEKACRSHGFVVLKEVRFLSLQALYPLLTDPSLNLHVVHLVRDPRAVFRSREHTTIELVVDSHIVLGQHLETIKEEDQPYYAMKIICKSQVDIVKAIQTLPEALQQRYLFLRYEDLVRAPLAQTTRLYKFVGLDFLPHLQTWVHNVTRGKGMGQHAFHTNARNALNVSQAWRWSLPYEKVSQLQDACGEAMDLLGYLQVRSQQEQGNLSLDLLSSSHILGQVFREG