CHLG

Chlorophyll synthase, chloroplastic

387 amino acids

Involved in one of the last steps of the biosynthesis of chlorophyll a. Catalyzes the esterification of chlorophillide a or b with a preference for geranylgeranyldiphosphate (GGPP) rather than for phytyldiphosphate (PhyPP).

Belongs to the UbiA prenyltransferase family. Chlorophyll synthase subfamily.

41.881 kDa

MTSILNTVSTIHSSRVTSVDRVGVLSLRNSDSVEFTRRRSGFSTLIYESPGRRFVVRAAETDTDKVKSQTPDKAPAGGSSINQLLGIKGASQETNKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWTPEDVAKSILCMMMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPSGAISEPEVITQVWVLLLGGLGIAGILDVWAGHTTPTVFYLALGGSLLSYIYSAPPLKLKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEGDRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQFKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH

CHLG

Chlorophyll synthase, chloroplastic

378 amino acids

Involved in one of the last steps of the biosynthesis of chlorophyll a. Catalyzes the esterification of chlorophillide a with either geranylgeranyldiphosphate (GGPP) or phytyldiphosphate (PhyPP). May also use with a lower efficiency the monophosphates GGMP and PhyMP, but not the non-phosphorylated alcohols geranylgeraniol and phytol. The tetraprenyl diphosphate must bind to the enzyme as the first substrate and esterification occurs when this pre-loaded enzyme meets the second substrate, chlorophyllide.

Belongs to the UbiA prenyltransferase family. Chlorophyll synthase subfamily.

40.764 kDa

MATSHPLAAAAATSSSSATFRPPLRFLSSPPSSLTLNRRRSFPVVCAADADAKETTKKPTIPDKAPAAGSSFNQLLGIKGAKQETNIWKIRLQLTKPVTWPPLVWGVLCGAAASGNFHWTVEDVTKSIVCMLMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPSGAISENEVITQIWVLLLGGLGLGALLDIWAGHDFPIIFYLALGGSLLSYIYSAPPLKLKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTCLYSIAGLGIAIVNDFKSIEGDRTLGLQSLPVAFGMETAKWICVGAIDITQLSVAAYLLSTGKLYYALALLGLTIPQVILQFQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH

CHLG

Chlorophyll synthase, chloroplastic

376 amino acids

Involved in one of the last steps of the biosynthesis of chlorophyll a.

Belongs to the UbiA prenyltransferase family. Chlorophyll synthase subfamily.

40.579 kDa

MATSHLLAAASSTAASSATFRPPLLSLRSPPPSSLRLNRRRHFQVVRAAETDKETKANAPEKAPAGGSSFNQLLGIKGAKQENDIWKIRLQLTKPVTWPPLVWGVLCGAAASGNFHWTVEDVAKSIVCMIMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPSGAISENEVITQIWALLLAGLGLGALLDVWAGHDFPIIFYLAVGGSLLSYIYSAPPLKLKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTSLYSIAGLGIAIVNDFKSVEGDRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLFSSGKPYYALALLGLTIPQVVFQFQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH