CGI121

EKC/KEOPS complex subunit CGI121

252 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

27.749 kDa

MESISLPWTLPEPLQQVHLAHFSNLDPATQSAAIIDRIISASRLPSASPEQAQQADEERVKLDFAFLDPTKLCSKLHLLSAVTQAAVVCARSWDDDRQVFREGEASIGGMKSKTPHSEVIYMLNPGNNVGESLKRFGLSPTSSSLLLVKFSSPTADKQAILQSMIDLVSPSNLTSPPTAEAHTPIDIDHAIRYGSYPTTPSTTAQVTDWKQLNKIYKLQIPSTLLNNKQDNQWYEKYQDIICTSVAMKLVAA

CGI121

EKC/KEOPS complex subunit CGI121

233 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

25.652 kDa

MAHVRTFTLPHYEAYPVHVALFKDVKNPSYLKSQLLEANPAFDYAFLDAAMVARLGIAWWSHAAANDRPQILSPTHLLSTTFITIHALCTHRQKTRTPHSELVFRLSPNNNIGESYKKFGISDTTTHLIAVKLPLKSSDAEAKEWLVDGEITNESVSQHLGSVVEGTSVEISEKGEELGQWCDIDKIRKVYKLGDGSAKKGKKGAAVNGDGAEKEGEKKQMEVVILGTIALKS

CGI121

EKC/KEOPS complex subunit CGI121

229 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

25.301 kDa

METYAYPAFPPEYSNIHIALFKNVTNAPQIRKRLIEASQMTGPEGDKAREEVDFGFVEANLLVSKEHLLIAILSTLLYAFPSTGPAPTDPPPLSDIADPDVSSLSLSSSSETRQPKTRSHNLHSELLLLLSPNNNITDSIRRHGVSDITTNLAVVKFGKRGDRVEEVYEAMKNVVEGELIGWEGISEGTDWARVDKIYKLNELNALKTADMVEKKRTAVISTVAIKNVI

CGI121

EKC/KEOPS complex subunit CGI121

229 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

25.301 kDa

METYAYPAFPPEYSNIHIALFKNVTNAPQIRKRLIEASQMTGPEGDKAREEVDFGFVEANLLVSKEHLLIAILSTLLYAFPSTGPAPTDPPPLSDIADPDVSSLSLSSSSETRQPKTRSHNLHSELLLLLSPNNNITDSIRRHGVSDITTNLAVVKFGKRGDRVEEVYEAMKNVVEGELIGWEGISEGTDWARVDKIYKLNELNALKTADMVEKKRTAVISTVAIKNVI

CGI121

EKC/KEOPS complex subunit CGI121

207 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

23.279 kDa

MSLIETHHLSYLPESHPVHVALYRDLQNASFLREQLLAGNTEFEYAFIDASMIFSRNHIFAAIFRAVRDYINNRLKSKNVHSEIVFSLGGSNNIADAFRRFGISESTRDLLVVKVSTAPEITHESVSKHLEHNIKALPCPFTEESLASMTDRARLRKVYKFGSVGADTFKRLDEVEQGKNGSETTKEAARKHIDMLLMGAIAIRGAT

cgi121

EKC/KEOPS complex subunit cgi121

207 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Cgi121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

23.238 kDa

MALETLQIEHVPSDHHVYAALFRDVQNVDFLQAQLIGKNPEFEYAFIDASVIISRTHLFAAIFRALNTLTEGTLQTPNVHSDIVIGLSPTNNISESYRRYGLTPSKTRDVLVIKIVYPKLSSENSTITSEQQPTPESIWQHLTTHIQGTPVPLTNEELAKSTDWAKVRKYYKLNGVPGVERIDKADEEGRRKEMEGLVISGIALRGL

CGI121

EKC/KEOPS complex subunit CGI121

203 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

23.374 kDa

MTSEVIKFPQFPEFTIHISLFINVSSENITTIKSNLISATDNDHNKYDYCFLNTKYIISKEHLFQSIYKSLLNYTSKLGLSTRNLKSEIIYNLSPINNVGDALKRFGISEDCPNCIVIKIINNNNKENSEETKISEKVTTDLKEIIDGELIELNDQYIFENFIDLAKFRKLYKLNDVVDLNKEDNLQGRLTRLAIGACILRGY

CGI121

EKC/KEOPS complex subunit CGI121

197 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

22.396 kDa

MVYEELKLAQFPNCTVLIFLFTGVDTPVLKQVKEQLISGNKDYDFCFLNPQHIISLEHLYSSIHKAVLNHEFGNMRAKTLNTEIIFNLSPINNIMDALKRFGVDEACPNLITIKVLPTSECNEIAFKDLNDHLLKILSTNDSHNPRLNNEIIFDSLVDLKKLKKVYKLNDAKFSKDESDLQGELTRLAIGACQLRGC

CGI121

EKC/KEOPS complex subunit CGI121

197 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

21.817 kDa

MALETVTLEHLPASHKVYVALFRGVKNAAFLHQQLLARNPEFEYAFIDASVVVSRLQLLSAVFKATSTAVNGALRTPNVHSEIVCTMSSSNNIADAYRRYGISPSTQDLVVVKVTFPGEDGAEPLTQDQIWEHLKTNVEGEAVSITDEQISIATDVPKVRKYYKLNGLKWLDDIQDEKVKQKEMESLVIGAMALRGV

cgi121

EKC/KEOPS complex subunit cgi121

195 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the n6 group of a37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Cgi121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

21.157 kDa

MSSTLETLNLSHIPLPVHVALYRDVQNAPFLRQQLISGNADFEYAFIDASMVLSRSHALSAVFRAINDYLNQRLKSRNVHSETVFSFSPNNNIADSFRRFGISDSTKDLLVVKVSVTPDVTHESVAAHLAQSVEGTPVPFDDETLSGISDIAKIKKAYKLGALSSAPSDKADGTNGEDRRLELSVIGAIALRGAT

cgi121

EKC/KEOPS complex subunit cgi121

190 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Cgi121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

20.759 kDa

MSASLETIQLPHLPSNLPVHIGLYRDVNNAPFLRQQLLSGNADFEYAFIDASMVFSRAHVLSAIFRAVNDSLNGRLKSRNVHSEIVFSLSPANNIAESFRKFGITDLTKDLLVVKVSVTPDITHNSVAEHLQQSIEGLSVPFTDTSLSEIGDVAKIKKAYKLGSLSTAQDDDKRRLELSLIGAIALRGAT

cgi121

EKC/KEOPS complex subunit cgi121

189 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Cgi121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

20.841 kDa

MTLPLETIRLPHLPSALPVHIALYRDVNNSPFLRQQLLSGNADFEYAFIDASMVFSRSHILSAIFRAVNDHLNGRLKSRNVHSEIVFSLSPANNIADSFRKFGITDSTTDLLVVKVSVTPDVTHASVATHLQQYIEGSPVPFADETLSEISDISKIKKAYKLGTLGSRDDEKRRLELSLIGAIALRGAT

CGI121

EKC/KEOPS complex subunit CGI121

181 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification.

Belongs to the CGI121/TPRKB family.

20.662 kDa

MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKTLIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQLRGV

CGI121

EKC/KEOPS complex subunit CGI121

178 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

20.069 kDa

MLTTTIPQFPDTKLYISLFRNVSNAPEIVDSLAELPYSIIDARTLLSREQLLSAVYRAMLEKHCNKLRTRNLHTEVLLCLSPTSNVMSQIGDAMKRFGIKKDSTSVVLVKAVTGDETFDPKGFSEVIRGEELEFSDTALRESADIDTIRENYKLKCFECERLEELSAALVHAIQLRGL

CGI121

EKC/KEOPS complex subunit CGI121

175 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

19.915 kDa

MNFKIPQFPDFEISITAFENVTNSESIRSKVATLPYAFLDARMIYSQEQLYAALYRVLVEQNYNKLRTKTIHSEIMLCLSPTSNIGDAFKKFGIKEDSSTVICLHIKDRSDEPELPSLSSIVEGQEISLSKEFINQHRDIGMVGHVYKINGEMIENSTEDQVSSMIVNMIQLRGL

cgi121

EKC/KEOPS complex subunit cgi121

174 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. Cgi121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

20.05 kDa

MILPLFPETQVHVFVYENVSNCAAIHEQLISQNPIYDYAFLDAATILYKKQVYSAIIRALEDRRDEQMKTKTIHSEVILSLSPKTEISSAFRQFSMTKKSKNIVVVKIDSKLTEEEEFERLDKLVEGNRVEFSDEELQKLIDFKVLKKNYKLDPSTLENPLASILSSIALRGYS

cgi121

KEOPS complex subunit Cgi121

171 amino acids

Component of the KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Cgi121 acts as an allosteric effector that regulates the t(6)A activity of the complex. Cgi121 is not required for tRNA modification.

Belongs to the CGI121/TPRKB family.

19.03 kDa

MTPKFKNFKHDNSGQVETYLFEVISKYTMLEIKTKFGKLCIAKVKLASESIERALNLCNDNCQIVSAKCHEEVIFATILAIKAFSSGRNTAKTIKGEILLRLAGVKQIKDAIKIIGARKGENLIIYFGVSDPCSSLKDFISSLGLREEPLKPCDEDEVKRGFERAAIIEAL

CGI121

EKC/KEOPS complex subunit CGI121

169 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

18.533 kDa

MKFPQFDQEIAISYFSDVKNAGQIRNELLSGNPDYQVAFINANTLLSSKHLLAAVYRAVSDQEAGSMKTKNVHSEVLFCLGGNNNIMDSLRRFGIQDDTTNIVAVKIGGGEYTKLVEGTEEPFTDEQIAKNTDIKLVKKVYKLPGTVSLDDRAQVETAAIGALLLRGFS

CGI121

EKC/KEOPS complex subunit CGI121

157 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification (By similarity).

Belongs to the CGI121/TPRKB family.

17.527 kDa

MAGIVLKYKIPQFQEYTIHVQKYNNVTNSSELRSKLAELPFAYIDSKTVISVEQLSSAIYKAILETEYNRMRTRTIHSECILSLSPSSNIGDALNRFGIKEGTTDIIVIKIIEDSNEEPYDGNASVDGDLVPVSDDEFSTSADKEIIKTVCIPCDKL

cgi121

Regulatory protein Cgi121

145 amino acids

Component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, a step in the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Cgi121 stimulates Bud32 kinase activity via an activation of Bud32 autophosphorylation.

Belongs to the CGI121/TPRKB family.

16.593 kDa

MIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIGAKDGNVCLICEDEETFRKIYELIGGEIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE