CFAP300

Cilia- and flagella-associated protein 300

267 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

30.691 kDa

MAAGEPGDLGVYSFRFLPQKTFQSLSTPQTTSRLRQWSMLGRIEAQAFGFDQTFQAYRKDDFVTAFFKDPNVIPNLKLLSESSGEWLTLGTEVKKIEAINVPCTQLSMSFFNRLYDEAIVRDNGYIVKCLDSFCDPFLISDELRKVLLVEDSEKYEVFSQPEREEFLFCLFKHLCLGGALCQYEDVINPYLETTKLIYKDLVSVRKNPQTKKIQITSSIFKVTAYDSVGVCYPSTKSHEQTFSYFIVDPIKRHVHVLYHCYGMGEVS

CFAP300

Cilia- and flagella-associated protein 300

267 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

30.859 kDa

MATGELGDLGGYYFRFLPQKTFQSLSSKEITSRLRQWSMLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS

Cfap300

Cilia- and flagella-associated protein 300

267 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

30.901 kDa

MAAGEPRDGGGYYFRFLPHRTFSSLSAREITSRLRQWSMLGRIQAQAFSFDQTFQPYQKDDFVMAFFKDPNVIPNLQLLSDSSGQWTTLGSEVKKIEAINVPCTQLSMSFFQRLYDENIVRESGHIVKCLDSFCDPFLISDELRKVLLMEDSEKYEVFSPVEREEFLFCLFKHLCLGGSLCQYEDVLKPYLETAKLIYKDLVSVRKHPRTKEIQITSSVFKVKAYDSVGVCYPSPKEHEQTFSYFVVDPIKRHVNVLYHCYGVGHMA

Cfap300

Cilia- and flagella-associated protein 300

267 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

31.058 kDa

MATGEPRDRGGYYFRFLPQRTFSSLSAREITNRLRQWSMLGRIQAQAFGFDQTFQPYQKDDFVTAFFKDPNVIPHLQLLAESSGQWTTLGTEVKRIEAINVPCTQLSMSFFQRLYDENIVRESGHIVKCLDSFCDPFLISDELRKVLLMEDSEKYEVFSPVEREEFLFCLFKHLCLGGSLCQYEDVLKPYLETAKLIYKDLVSVRKHPRTKEIQITSSVFKVKAYDSLGVCYPSPKEHEQTFSYFVVDPIKRHVNVLYHCYGVGEMA

cfap300

Cilia- and flagella-associated protein 300

267 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

30.709 kDa

MSAGSFSTEAAKFSFSPILNKTFGFLTNRDTRELLMKWSMNGRITAQAFRYDECFQPYQKNDFVWAFFQDPDVLSHLKIVSENSGQWVTLGTKVKKVDVQEILCSQLSMSLFDCLYSEGIVRESGHICKCLDEYLDDFTISDELRKVLLLDDCEKHDVFSQSDREQFLFLLFKHLCLGGAICQFEDTIGPYLETTKSIYKDLLSVQKDPETKQIRIISTVFKVSAYDENGMCYPSGRPHQQTFAYLIVDPLKRHVYVLYHCFGGGAF

CFAP300

Cilia- and flagella-associated protein 300

257 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Plays a role in outer and inner dynein arm assembly.

Belongs to the CFAP300 family.

29.163 kDa

MTAFVPVSLPSTSALNDAYVKSQLTKWDLLRNLRCVAVRYTKYYHKLQGQELLADLFRDEKVQEAFQVLRKGGAWGQLGGPVTKVDATLLASSLTRMDLFDKLTETSPPIVRSNGDIGKCMEDNREGFQVSDQLRELILVEESEHAALFSEAERDELLWRLFEHVVLGGACCQFEDKVEPYVETSKRLYKELVCAQKDPATGKVQTVSAVYKINSIQGDSGPLELYPSRSRQNFCYAAVDPVRRIVKILYHAYVPYW

CFAP300

Cilia- and flagella-associated protein 300

252 amino acids

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Plays a role in outer and inner axonemal dynein arm assembly.

Belongs to the CFAP300 family.

30.046 kDa

MQIESDNQVTNQSYSFFRQENTILDDKKFMEILQKWGLQHSIKVSTFLFDIKFDHLNPNQFLLDLFNSKDVRGSLHYVSFKQNVLLSQIKFQPLTCKSIKLDLFDKLTEDKIVVKGHIKQCFEEQFENIQIADELRKALVLEDSEQYCVFNEADRQELLFKLFQILVLGGQLCQYEDEIQAYLDWTKYLYKNTVNARKYADKDEIYIDSYAYDIRKLENSYSSDHPQNVMYVVVNPSLRIVNIIENQWLKVW