CERK1

Chitin elicitor receptor kinase 1

640 amino acids

Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to biotic stresses (By similarity). The CERK1, MEKK1a/b, MKK1a/b/c and MPK4a/b proteins are involved in pathogen defense. The pathway induces rapid growth inhibition, cell wall depositions and accumulation of defense-related transcripts. This protein is required for response to chitin. Is able to complement the A.thaliana cerk1 mutant (PubMed:27268428).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

70.884 kDa

MKFQMKMKSELCRTYKYWLILLVLWLSGVTQRETGVLIVDADCIPPNGCKALAYYRLKQGDDLEKLQGRFQTNNSEVLAYNPQLVDANSIQAGTNIYLPFDCLCLNGELVHRFSYTVTTNDTAEKVVDVTYQKLTTVGAVRSASNSGDLSSIYSGQSLTIPVRCYCGDPNVDPKYGLFSTYVVQADDQLTSLSTNFSVDADVISKFNSDTRNLSPDSIIFIPSKAANGSFPPFSGYVLGTVHWRSNVGIIVGVVVGGIVLAVLLLFALIFGFKHFRRRKLAKEPTMQQSGLLSSSSMAGSKPSRSGSTMLPVPKSVEFTYEELAAATDNFSLAKKIGQGGFASVYYGVIRDQKLAIKKMTLQCTKEFLAELQVLTNVHHTNLVQLIGYCTTNSLFLVYEYIENGTLDHHLRRRKSDDKPPLSWLQRVQICLDSARGLEYIHEHTKPTYIHRDIKSANILLDDNFRAKVADFGLAKLAEEGTGTGIVGTFGYMPPEYALYGEVSPKLDVYAFGVVLFEIISGRVAISSALPSENDQQSPAQNRESRTLTSFFEPVLNDPDGKTLLPKCIDPALNGEYSLDAVWKMAQLARRCTHQSPDMRPTMRFAVVQLMTLASVTQEWDVGYFSRASSQSQPPSGNDQL

CERK1

Chitin elicitor receptor kinase 1

624 amino acids

Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to biotic stresses. Involved in the resistance to pathogenic fungi, probably by sensing microbe-associated molecular patterns (MAMP) and pathogen-associated molecular patterns (PAMP) (PubMed:21070404, PubMed:22891159, PubMed:24964058). Involved in the detection of microbial peptidoglycans (PGNs) and mediates PGN response (PubMed:24964058). Plays dual roles in PGN and chitin signaling during innate immunity. Acts as an adapter for LYP4 and LYP6 and mediates signal transduction from the extracellular to intracellular spaces. Participates to the activation of defense genes during response to PGN and chitin (PubMed:25335639). Phosphorylates the downstream partner RLCK185 in response to chitin elicitation (PubMed:23498959).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

67.068 kDa

MEASTSLLVLVLAAAAFAAGTVTEAAGDGCSAGCDLALASFYVTPNQNVTNMADLFGIGAANYRSLAPYNPNIPNLDFINVGGRVNVYFTCGCRSLPGSPGATYLAGAFPFQMSRGQIYTSVAANYNNLTTAEWLQATNSYPANNIPDTAVINATVNCSCGDASISPDYGLFLTYPLRAEDTLASVAATYGLSSQLDVVRRYNPGMESATGSGIVYIPVKDPNGSYLPLKSPGKGASAGAIAGGVVAGVVVLAAIFLYIIFYRRRKAKQATLLQSSEDSTQLGTISMDKVTPSTIVGPSPVAGITVDKSVEFSYEELSNATQGFSIGNKIGQGGFGAVYYAELRGEKAAIKKMDMQATHEFLAELKVLTHVHHLNLVRLIGYCIESSLFLVYEFIENGNLSQHLRGMGYEPLSWAARIQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYRAKVADFGLTKLTEVGGTSMPTGTRVVGTFGYMPPEYARYGDVSPKVDVYAFGVVLYELISAKEAIVRSTESSSDSKGLVYLFEEALNSPDPKEGLRTLIDPKLGEDYPIDSILKLTQLAKVCTQEDPKLRPSMRSVVVALMTLSSTSEFWDMNNLYENQGLVNLMSGR

CERK1

Chitin elicitor receptor kinase 1

617 amino acids

Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity toward both biotic and abiotic stresses (e.g. tolerance to salinity, heavy-metal stresses, and Botrytis cinerea infection). Recognizes microbe-derived N-acetylglucosamine (NAG)-containing ligands. Involved in the resistance to pathogenic fungi Alternaria brassicicola and Erysiphe cichoracearum, probably by sensing microbe-associated molecular patterns (MAMP) and pathogen-associated molecular patterns (PAMP). Plays an essential role in detecting peptidoglycans (e.g. PGNs) and restricting bacterial growth. Target of the bacterial type III effector E3-ligase protein hopAB2/avrPtoB of Pseudomonas syringae pv. tomato DC3000 that mediates ubiquitination and subsequent proteolysis, thus blocking all defense responses by suppressing PAMP-triggered immunity (PTI). Mediates chitin-induced phosphorylation of PBL27 (PubMed:24750441).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

67.315 kDa

MKLKISLIAPILLLFSFFFAVESKCRTSCPLALASYYLENGTTLSVINQNLNSSIAPYDQINFDPILRYNSNIKDKDRIQMGSRVLVPFPCECQPGDFLGHNFSYSVRQEDTYERVAISNYANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDESVSKDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGIVYVPGRDPNGAFPPFKSSKQDGVGAGVIAGIVIGVIVALLLILFIVYYAYRKNKSKGDSFSSSIPLSTKADHASSTSLQSGGLGGAGVSPGIAAISVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLVYEYVENGNLGQHLHGSGREPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEVGGSATRGAMGTFGYMAPETVYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNEDLVSLMSGR