CEBPD

CCAAT/enhancer-binding protein delta

269 amino acids

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:1741402, PubMed:16397300). Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (PubMed:1741402).

Belongs to the bZIP family. C/EBP subfamily.

28.467 kDa

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Cebpd

CCAAT/enhancer-binding protein delta

268 amino acids

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:7594592, PubMed:19641492). Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (By similarity).

Belongs to the bZIP family. C/EBP subfamily.

28.631 kDa

MSAALFSLDSPVRGTPWPTEPAAFYEPGRVDKPGRGPEPGDLGELGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAAGAGGLELLQGGPTRPPGVGSVARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGTVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKLPSPPFLPPTGADCR

Cebpd

CCAAT/enhancer-binding protein delta

268 amino acids

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:1714459). Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (By similarity).

Belongs to the bZIP family. C/EBP subfamily.

28.6 kDa

MSAALFSLDSPARGAPWPTEPAAFYEPGRVGKPGRGPEPGDLGEPGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDEIFADLFNSNHKAAGAGSLELLQGGPTRPPGVGSIARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGPVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLASLRQFFKELPSPPFLPPTGTDCR

CEBPD

CCAAT/enhancer-binding protein delta

256 amino acids

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB.

Belongs to the bZIP family. C/EBP subfamily.

27.137 kDa

MSAALFSLDGPARGAPWTAEPAAFYEPGRAGKPGRGAEPAASAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGALELLPGGPARLGGPGPAPRPLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAAQPTPPASPEPPRRSPAPPAPGPARDKAAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLQQRVEQLTRDLAGLRRFFKQLPGAPFLPGAGAADAR

CEBPD

CCAAT/enhancer-binding protein delta

255 amino acids

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:10799300). Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB (By similarity).

Belongs to the bZIP family. C/EBP subfamily.

27.04 kDa

MTCALQPGRPSGGAPWTAEPAAFYEPGRAGKPGRGAEPAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGALELLPGGPARLGGPGPAPRPLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAPAAQPTPPASPDPPRRSPAPPAPGPARDKAAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLQQRVEQLTRDLAGLRRFFKQLPGAPFLPGAGAADAR