About Services Proteins Contact

CD200R1B

Gene
CD200R1B
Protein
Cell surface glycoprotein CD200 receptor 1-B
Organism
Gallus gallus
Length
243 amino acids
Similarity
Belongs to the CD200R family.
Mass
26.233 kDa
Sequence
MEISQQAGWCKKPASPMNTRAALEAVRNTAWTIVLLTSAAVMGASGISRVSANLGHSTVMTCPNRTNISMVTWKINPKTGHQCTLAYLIDKDSTGKNSCSDRINWRSRPDWDQALEIQQVGKADEGNYTCEVVNADGNFHYLYHLTVLVAPRMALYCDDHGNPVCEAETVKPAAEISWVPESNSTPRADSHGNGTVTVVSRFAARSTNGKNPTCIVSHATLNETRSINCSSRTLAQLPGGSAP