About Services Proteins Contact

CCNA2

Gene
CCNA2
Protein
Cyclin-A2
Organism
Homo sapiens
Length
432 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
48.551 kDa
Sequence
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Gene
CCNA2
Protein
Cyclin-A2
Organism
Homo sapiens
Length
432 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
48.551 kDa
Sequence
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Gene
CCNA2
Protein
Cyclin-A2
Organism
Bos taurus
Length
430 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
48.262 kDa
Sequence
MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGPAPQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV

Gene
CCNA2
Protein
Cyclin-A2
Organism
Bos taurus
Length
430 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
48.262 kDa
Sequence
MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGPAPQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV

Gene
Ccna2
Protein
Cyclin-A2
Organism
Mus musculus
Length
422 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
47.269 kDa
Sequence
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV

Gene
Ccna2
Protein
Cyclin-A2
Organism
Mus musculus
Length
422 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
47.269 kDa
Sequence
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV

Gene
CCNA2
Protein
Cyclin-A2
Organism
Mesocricetus auratus
Length
421 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
47.327 kDa
Sequence
MPGSSRQSGREAGSALLSLQQEDQENVNPEKAAPDQRARAALKTGNARGNAPQQRLKARRVAPLKDLSINDEHVASGPSWKAASKQPAFTIHVDEEEDTQKIPPEHKEMRCEDALAFNAAVSLPGARKPLVPLDYPMDGSFESPHAMDMSIVLEEEKPVSVNEVPDYHEDIHTYLREMEIKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLNQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAAQHTQQSIREKYKHSKYHGVSLLNPPETLNV

Gene
CCNA2
Protein
Cyclin-A2
Organism
Mesocricetus auratus
Length
421 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
47.327 kDa
Sequence
MPGSSRQSGREAGSALLSLQQEDQENVNPEKAAPDQRARAALKTGNARGNAPQQRLKARRVAPLKDLSINDEHVASGPSWKAASKQPAFTIHVDEEEDTQKIPPEHKEMRCEDALAFNAAVSLPGARKPLVPLDYPMDGSFESPHAMDMSIVLEEEKPVSVNEVPDYHEDIHTYLREMEIKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLNQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAAQHTQQSIREKYKHSKYHGVSLLNPPETLNV

Gene
ccna2
Protein
Cyclin-A2
Organism
Xenopus laevis
Length
415 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
46.67 kDa
Sequence
MSDHLLRDEHQENVQPRKLLVPVGGRTVLGVLQENHRGPKALKVSKPALQQTQVLSVNHLGVNDENYGKIPARKAASKQPAFTIHVDEPDCATNKRKAVHKKTVQDENLQQLNSVLGSIGTRKPLHPIQIAMETSFGSPMDVSIVDEEQKVVGCNNVADYAKEIHTYLREMEVKCKPKAGYMQKQPDITGNMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLKMEHLVLKVLSFDLAAPTILQYLNQYFQIHPVSPKVESLSMFLGELSLVDADPFLRYLPSVVAAAAFVIANCTINERTWSDPLVEYTSYTLETLKPCILDLYQTYLSAASHQQQAVREKYKAPKNHAVSLIIPPESMSTFL

Gene
ccna2
Protein
Cyclin-A2
Organism
Xenopus laevis
Length
415 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
46.67 kDa
Sequence
MSDHLLRDEHQENVQPRKLLVPVGGRTVLGVLQENHRGPKALKVSKPALQQTQVLSVNHLGVNDENYGKIPARKAASKQPAFTIHVDEPDCATNKRKAVHKKTVQDENLQQLNSVLGSIGTRKPLHPIQIAMETSFGSPMDVSIVDEEQKVVGCNNVADYAKEIHTYLREMEVKCKPKAGYMQKQPDITGNMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLKMEHLVLKVLSFDLAAPTILQYLNQYFQIHPVSPKVESLSMFLGELSLVDADPFLRYLPSVVAAAAFVIANCTINERTWSDPLVEYTSYTLETLKPCILDLYQTYLSAASHQQQAVREKYKAPKNHAVSLIIPPESMSTFL

Gene
CCNA2
Protein
Cyclin-A2
Organism
Gallus gallus
Length
395 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
44.08 kDa
Sequence
MLAEQENQENVPPAAKAPPPAAGTRVALGLLRGGPARPGPAAQAARNGEGRGAAAGQQQQPFSVYVDEPDEERRRPQRKKERDEEAADAPGLRAALGTVGERRPLAPLGNAMELSLDSPSIMDISITSEAEERPNVNNVPDYVSDIHTYLREMEVKCKPKIGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYNKKQVLRMEHLILKVLSFDLAAPTINQFLTQYFLHQQTNAKVESLSMYLGELTLIDADPYLKYLPSVIAAAAFHLASYTITGQTWPESLCKVTGYTLEHIKPCLMDLHRTYLKAAQHTQQSIREKYKSTKYHAVSLIDAPETLDL

Gene
CCNA2
Protein
Cyclin-A2
Organism
Gallus gallus
Length
395 amino acids
Function
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Similarity
Belongs to the cyclin family. Cyclin AB subfamily.
Mass
44.08 kDa
Sequence
MLAEQENQENVPPAAKAPPPAAGTRVALGLLRGGPARPGPAAQAARNGEGRGAAAGQQQQPFSVYVDEPDEERRRPQRKKERDEEAADAPGLRAALGTVGERRPLAPLGNAMELSLDSPSIMDISITSEAEERPNVNNVPDYVSDIHTYLREMEVKCKPKIGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYNKKQVLRMEHLILKVLSFDLAAPTINQFLTQYFLHQQTNAKVESLSMYLGELTLIDADPYLKYLPSVIAAAAFHLASYTITGQTWPESLCKVTGYTLEHIKPCLMDLHRTYLKAAQHTQQSIREKYKSTKYHAVSLIDAPETLDL