CCL25

C-C motif chemokine 25

151 amino acids

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

17.109 kDa

MNLWLLVCLVASLMGAWSTVHTQGVSEDCCLAYHHRARPRLLMRAQGYQRQEVSGSCNLPAVIFFFPKNKMLCVNPRVNWLPNVFKFLDNRNNTHSKQHLGSRRNLQDSHLGGQRSNTGMSRLAHSKSKSSRSTRSNKKKTSFLNMANPGP

CCL25

C-C motif chemokine 25

151 amino acids

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

16.878 kDa

MRPWLLACLVACFVGAWAPAIHAQGAFEDCCLAYHSHIKWRLLRRAHSYQRQDVSGSCNLPAVIFFFPQKDKMVCGKPGAKWVQFGMKILDNRNKKDSKPHHSGRRFFQGPQSGVRKLSSGTSRPLLLKFSGPTRSSKRKASLLTTAIPGP

CCL25

C-C motif chemokine 25

150 amino acids

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Belongs to the intercrine beta (chemokine CC) family.

16.609 kDa

MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Ccl25

C-C motif chemokine 25

144 amino acids

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Belongs to the intercrine beta (chemokine CC) family.

16.733 kDa

MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN