Castor1

Cytosolic arginine sensor for mTORC1 subunit 1

331 amino acids

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.

Belongs to the GATS family.

36.575 kDa

MELHILEHRVRVLSIARPGLWLYTHPLIKLLFLPCRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVMNVSHSGSVVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFQIYREVGGEPVPVTGDDSSNGFPQIQHGPSPTVHPIQSPQNRFCVLTLDPETLPAVATTLIDVLFYSHSVPKEAASGGPESTSIPFFAFSLIEGYISIVMDAEIQRKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAVDISAYYISTFNFDHALVPEDEIGCVIDILQRRQESQASKDP

Castor1

Cytosolic arginine sensor for mTORC1 subunit 1

331 amino acids

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.

Belongs to the GATS family.

36.476 kDa

MELHILEHRVRVLSLARPGLWLYTHPLIKLLFLPSRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVMNVSHSGSVVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAREFQIYREVGGEPVPVTGDDSSNGFPQAQHGPSPTVHPIQSPQNRFCVLTLDPETLPAVATTLIDVLFYSHSVPKEAASGGPESTSIPFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAVDVSAYYISTFNFDHALVPEDEISCVIDILQRRQEGLASKDP

CASTOR1

Cytosolic arginine sensor for mTORC1 subunit 1

329 amino acids

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.

Belongs to the GATS family.

36.041 kDa

MELHILEHRVRVLSLARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSPSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAREFDIYREVGGEPVPVARDDSSNGFPRAQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSPPREAASGGPGSSSIAFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQDGLGS

CASTOR1

Cytosolic arginine sensor for mTORC1 subunit 1

329 amino acids

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.

Belongs to the GATS family.

36.275 kDa

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS

CASTOR1

Cytosolic arginine sensor for mTORC1 subunit 1

329 amino acids

Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.

Belongs to the GATS family.

36.405 kDa

MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDFSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHRTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS