casp3

Caspase-3

282 amino acids

Important mediator of apoptosis. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond (By similarity).

Belongs to the peptidase C14A family.

32.125 kDa

MEESQNGVKYGGDATDAKEYFTIQPRSLQNCDLKDIERKTKFAHLQNYRTNYPEMGMCLIINNKNFHSSNMAVRNGTDVDALKLHETFTGLGYEVMVCNDQKSSDIIGRLKKISEEDHSKRSSFVCAILSHGEEDGSICGVDVPIHIKNLTDLFRGDRCKTLVGKPKIFFIQACRGTELDSGIETDSCSEPREEIQRIPVEADFLYAYSTVPGYCSWRDKMDGSWFIQSLCKMIKLYGSHLELIQILTCVNHMVALDFETFHAKKQIPCVVSMLTKSFYFFK

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.335 kDa

MENTENSVDAKSFKNAETKILHGSKSMDSGMSFDNSYKMDYPEMGLCIIINNKNFHKSTGMAPRSGTDVDAANLRETFTNLKYEVRNKNDLTCEEILELMNSVSKEDHSKRSSFVCVLLSHGDEGIIFGTNGPVDLRKVTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGIEDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYLYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.466 kDa

MENSENSVDAKSIKNSETKIFHGSKSMDSGIYMDNSYKMDYPEMGLCIIINNKNFHESTGMPSRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIVALLDSVSREDHSKRSSFICVLLSHGEEGIIYGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTEDDIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHELEFMHILTRVNRKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage.

Belongs to the peptidase C14A family.

31.608 kDa

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.286 kDa

MENTENSVDSKSIKSLEPKIIHGSKSVDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMASRSGTDVDAANLRETFINLKYGVRNKNDLTREEIVELMRNVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPLDLKKITSFFRGDCCRSLTGKPKLFIIQACRGTELDCGIEADSGVEDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.612 kDa

MENNETSVDSKSIKNFEVKTIHGSKSMDSGIYLDSSYKMDYPEMGVCIIINNKNFHKSTGMTPRSGTDVDAAKLRETFMALKYEVRNKNDLTREEIVELMKNASKEDHSKRSSFVCVILSHGDEGVIFGTDGPIDLKKLTSYFRGDYCRSLIGKPKLFIIQACRGTELDCGIETDSGTEDDMTCQKIPVEADFLYAYSTAPGYYSWRNPKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH

Casp3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity). Cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes.

Belongs to the peptidase C14A family.

31.475 kDa

MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.607 kDa

MENTENSVDSKSIKNLEPKIIHGSQSMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.379 kDa

MENNKTSVDSKSIKTLETKILHGSKSMDSGISLDVSYKMDYPEMGLCIIINNKNFDKNTGMACRSGTDVDAANLRETFTNLKYEVRNKNDLTREEILELMHSVSKEDHSKRSSFICVLLSHGEEGKIFGTNGPVDLKKLTSFFRGDCCRTLTGKPKLFIIQACRGTELDCGIETDSGTEDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAALKQYVHKLELMHILTRVNRKVAVEFESFSTDSTFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.653 kDa

MENNETSVDAKSIKNLETQTIHGSKSMDSGKYLDNSYKMDYPEMGLCIIINNKNFHKNTGMSSRSGTDVNAANLGETFMNLKYEVRNKNDLTREEIMELMYNVSKEDHSKRSSFICVILSHGDEGVIYGTNGPIELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDSGIETDSGVDYDMACQKIPVEADFLYAYSTAPGYYSWRNSEEGSWFIQSLCAMLKEYAHKLEFMHILTRVNRKVATEFESYSLDATFHAKKQIPCIVSMLTKELYFYH

Casp3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.492 kDa

MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH

CASP3

Caspase-3

277 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.394 kDa

MENTENSVDSKSIKNSEPKIIHGSKSVDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMASRSGTDVDAANLRETFMNLKYEVRNKNDLTREEIVELMRNVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITSFFRGDCCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKQYAHKLEFMHILTRVNRKVATEFESSSFDATFHAKKQIPCIVSMLTKELYFYQ

CASP3

Caspase-3

275 amino acids

Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage (By similarity).

Belongs to the peptidase C14A family.

31.136 kDa

MENTENSVDSKSIKTSETKILHGSKSMDSGISLEESYKMDYPEMGLCIIINNKNFHENTGMACRSGTDVDAANLRETFMNLKYEVRIKNDLTCKEMLELMSNVSKEDHSKRSSFICVLLSHGEEGIIFGTNGPVNLKKLASFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGAEDDMACQKIPVEADFLYAYSTAPGYFSWRNAKNGSWFIQALCEMLKKHAHRLELMHILTRVNRKVAIEYESFSTDSAFHAKKQIPCIMSMLTKELYF

CASP3

Casparian strip membrane protein 3

221 amino acids

Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.

Belongs to the Casparian strip membrane proteins (CASP) family.

24.161 kDa

MDIEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQGTSGAVVASFIAATLLMFLVILSAFALKRTT