CAF1

CRS2-associated factor 1, chloroplastic

674 amino acids

Required for the splicing of group IIB introns in chloroplasts. Forms splicing particles with CRS2. Interacts with RNA and confers intron specificity of the splicing particles.

75.145 kDa

MATARLPSRSFLSPAQQSYPRLPASVRLCLSHHEQPPTGPKRHRRAATSHPAFSAAARGRAKKIPIADTDEPAAGVRVTDRGISYRLDGAPFEFQYSYTEAPRARPVALREAPFMPFGPEATPRPWTGRKPLPKSRKELPEFDSFVLPAPGKKGVKPVQSPGPFLAGMEPRYQSVSREDILGEPLTKEEVSELVKGSLKSKRQLNMGRDGLTHNMLENIHSHWKRKRVCKIKCKGVCTIDMDNICHQLEEKVGGKVIHRQGGVIFLFRGRNYNYRTRPCFPLMLWKPVAPVYPRLVTKVPGGLTPDEATEMRTRGHQLPPICKLGKNGVYANLVNQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCILLSFEFEHILMWRGSDWKSSLPPLENSYEVTKVQESFSGKESNEKVTHSGNVLAQIELVSAATSHKNWNLDEGQEKFKDSTDSDMVLNSAKDVPALFHSTGISRTEPSADIPLEYSPLNPVCDIMDPSLNCRSIPTNNCESRALVEKSEHCPDDYNLEMKRKRNDGTKGTVVLNSGSKVEGLLCLLEQAIHSGRALVLSEDELADSDLVYEKSVAFTKSIPRRLVFENTRRKSSARRNVPDNHARTKTHLVENKMLSSPVENKFIVNGGSAMQTIDHGQEFLSDVVHQGTLRVDELAKLLA

Caf1

Probable histone-binding protein Caf1

430 amino acids

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the nucleosome remodeling and deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the nucleosome remodeling factor (NURF) complex, which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin; and the polycomb group (PcG) repressor complex ESC-E(Z), which promotes repression of homeotic genes during development. Also required for transcriptional repression of E2F target genes by E2f2 and Rbf or Rbf2.

Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.

48.635 kDa

MVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA

caf1

Poly(A) ribonuclease pop2

335 amino acids

Acts as the catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. In vivo and in vitro, caf1 has 3'-exoribonuclease activity with a preference for poly(A) RNAs.

Belongs to the CAF1 family.

37.533 kDa

MTAMNSNFSYPALGVDGISSQISPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGLGSTGSVLWHNNSSTPQIQFRDLPGAHPSPTPSNAGIPTTLTNTSSAPNFANSTFRFPPRVV

caf1

F1 capsule antigen

170 amino acids

17.666 kDa

MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ