About Services Proteins Contact

Bcer98_0695

Gene
Bcer98_0695
Protein
UPF0342 protein Bcer98_0695
Organism
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Length
117 amino acids
Similarity
Belongs to the UPF0342 family.
Mass
13.572 kDa
Sequence
MSKNIHDVAYGLQKAIADHTDFKTLKESYAKVQGDADSKQLFDTFRNMQLEIQQKMMQGQEITEEDNKKAQEVIDLIQQNEHIKKLMEAEQRLNVVIGDINKIIMKPLEELYSAYQA