Protein
mRNA-decapping protein g5R
Organism
African swine fever virus (strain Badajoz 1971 Vero-adapted)
Function
Decapping enzyme required for the removal of the 5'-end m7GpppN cap tethered to viral and host mRNAs to allow their decay in cells (PubMed:19695654). May therefore accelerate viral and cellular mRNA turnover to eliminate competing host mRNAs and allow stage-specific synthesis of viral proteins. Acceleration of the turnover of cellular transcripts may even promote the shutoff of host protein synthesis (PubMed:29021398). In addition to the mRNA cap, g5R also efficiently hydrolyzes diphosphoinositol polyphosphates. Down-regulation of the level of PP-InsP5 (diphosphoinositol pentakisphosphate) may play a role in viral manipulation of the cellular secretory pathway, a step necessary for the formation of virions (PubMed:11773415). Binds viral and cellular poly(A) mRNAs, thereby decreasing both types of mRNAs (PubMed:19695654, PubMed:29021398).
Similarity
Belongs to the Nudix hydrolase family. DIPP subfamily.
Sequence
MDTAMQLKTSIGLITCRMNTQNNQIETILVQKRYSLAFSEFIHCHYSINANQGHLIKMFNNMTINERLLVKTLDFDRMWYHIWIETPVYELYHKKYQKFRKNWLLPDNGKKLISLINQAKGSGTLLWEIPKGKPKEDESDLTCAIREFEEETGITREYYQILPEFKKSMSYFDGKTEYKHIYFLAMLCKSLEEPNMNLSLQYENRIAEISKISWQNMEAVRFISKRQSFNLEPMIGPAFNFIKNYLRYKH